KEGG   Mycoplasma agalactiae 5632: MAGa2120Help
Entry
MAGa2120          CDS       T01192                                 

Gene name
pknB
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mal  Mycoplasma agalactiae 5632
Brite
KEGG Orthology (KO) [BR:mal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mal01001]
    MAGa2120 (pknB)
Enzymes [BR:mal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MAGa2120 (pknB)
Protein kinases [BR:mal01001]
 Serine/threonine kinases: Other
  Bacterial family
   MAGa2120 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Pkinase_fungal FTA2 Kinase-like APH Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: CBH40441
UniProt: D3VPN1
LinkDB All DBs
Position
245695..246690
Genome map
AA seq 331 aa AA seqDB search
MIPSNSRVYKKYKVLTKIGEGGFSKVFKVELLNSDSVVKEVYALKYFVIKPDSDKNVAIS
RFKQEIAILQKVKSDYFPYYVESYIGDDEQYLVMEYVEGKSLRELIKKNGVLNPHSSINY
VRQICEAMQELHSNNIIHRDIKSNNIIITSNSHVKILDFGLSLDPDSQRFTQASKVVGSV
YYMAPELCRADNEPTKKTDIYAIGILLYEMLTGKYPIEGKKADETLILQKTMPMPKLTDK
IATTQALENVIIKATAKDPFHRYSSAWEMAEDLKTALSEKRIFEKPIDAKKMKPKKTITE
IVNSKGFLIAMLVIFSLIILAVIVAIIVLSV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgattccatcaaatagcagggtctataaaaagtacaaggtgcttacaaaaattggcgaa
ggaggctttagcaaagtctttaaagtcgaattattaaattctgattcagttgttaaagaa
gtttatgcacttaaatattttgtaattaagcctgatagtgacaaaaatgtggcaattagc
cgttttaaacaagaaattgcaattttgcaaaaagttaaatctgattattttccttactat
gttgaatcatatattggcgatgatgagcagtatttagtaatggaatatgttgagggcaaa
agcttaagagaattaattaaaaaaaatggcgtgcttaatcctcatagctcaataaattat
gtaagacagatatgtgaagctatgcaagagttgcactcgaataatattattcaccgtgat
attaagagcaacaatatcatcataactagcaatagtcatgtaaaaatattagattttggt
ctttcactagatcctgatagtcaaagatttacacaagcctcaaaagttgtgggttcagtt
tattatatggcacctgagctctgccgtgctgataatgagcctactaaaaaaacagatatt
tatgcaatcggaatcttactttatgaaatgctaactggcaaatatccaattgaaggcaag
aaagctgatgaaactttaatattgcaaaaaacaatgccaatgcctaagctaactgacaaa
atcgcaactacgcaagcactagaaaatgtaattattaaagcaactgcaaaagatccattt
catagatactcaagtgcgtgggaaatggcagaggatttaaaaacagcactttcagaaaaa
agaatatttgaaaagccaattgatgctaagaaaatgaagcctaaaaaaacgattacggag
atagtaaacagcaaaggttttttgattgctatgcttgttattttcagcttaattatttta
gctgtcatagttgcaattatagttttatcagtataa

DBGET integrated database retrieval system