KEGG   Monopterus albus (swamp eel): 109951160
Entry
109951160         CDS       T05607                                 

Definition
(RefSeq) p53-induced death domain-containing protein 1-like
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109951160
   04115 p53 signaling pathway
    109951160
SSDB
Motif
Pfam: LRR_8 Peptidase_S68 ZU5 LRR_4 LRR_6
Other DBs
NCBI-GeneID: 109951160
NCBI-ProteinID: XP_020441133
LinkDB
Position
Unknown
AA seq 701 aa
MFKGGVPDPSSDTLAQRLWGGLVLQDQDKSQRKIPGGVMSEGQAERNSSSASPPSLVNTS
GLSISSLSSSSFFSNHHHASFYSPSTSSSPSVLSLTPPLPPSVELSAVLTDTRLTLDVYQ
RGTAALPLLWASIPGQLGGLQYLRLGSEDKPGLDGALDVIPHLTELRSLAIRGHCFYDSQ
GDPLPGLLTTLPASFSSLTHLVHLDLSFNQLSCLPSCLLILPALSSLLLCHNRLSALPHD
IGQLCCLTYLSLLGNELVSLPPSLGQLKSLQTLDLSYNLLQHLPDEIGSLEELVKLELSH
NKLKQLPESIGSLFSLRELVIYSNDLHMIPHCLKNRPLLKIDVRDNPLGQPPIHPPLPPT
PDHAEAKVLELHLGYNQHSFCVSPAGCHVFLPGGAELLFPPGCLETATRLEWVEKRPERK
WVWLEEHEILLSRPLELRPHGITFIKPVEVCVPYRRTKRRQVVVRRFDGQSWSTLPTDLR
RGSDSHSSHPGGRPARLACCSVSQFSWFMAVSHPVKDSCSVTPAGALLVSSSDPGIKLHF
PPDSTVQTRTIILQVLQVSVSEVQAVCGDPQARVSPLLCLSQTPSTHFLQPIKVQIPLPS
GVTGHTVDMSCLHLLHGDPAAQTWTDITSQVSLYVTHLYAIFYVTHFSWYWLWYTTQRCV
SGVVRKVYQRLKQFKVQFLVLQRRTDASQVLLQCLPANKQL
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgtttaaaggtggagtaccagacccctcttcagacactttggcccagaggctctgggga
ggtcttgtgctccaggatcaggataaatcacagaggaagataccaggtggtgtcatgtct
gaaggccaagccgagaggaattcttcctctgcatctccccccagcctcgtgaacaccagt
ggtctttctatttcaagcctttcgtcctcctcattcttctccaaccaccatcatgccagc
ttttattcaccatcaacatcttcgtcaccctcagtcttgtctctgacgccacccttgcct
ccttctgtggagctctcagctgtgttgactgatacaaggctgaccctggatgtatatcag
agaggaacagctgcactgccattgttatgggcatccatccccgggcagctggggggcctc
cagtatctcagactgggttctgaggataaaccaggtctggatggtgcactggatgttata
ccccatctgacagagctgcgttcactggctatacgggggcactgtttttatgactcacaa
ggtgaccctctgcctggcctcctcaccactttgcctgcatctttttcctctcttacacat
ctggtgcatctggatctctccttcaaccagctctcctgtctgccgtcctgcctactcatc
ttgcctgcactgtcctccttgctcctctgtcacaaccgcctctcagctttgcctcatgat
ataggccagctgtgctgcctcacctacctctccctcctggggaacgagctggtctctctt
cccccaagtctgggtcagctgaaatcactacagacactggatctttcatataacctcctc
cagcatctacctgatgaaattggttctctggaggagcttgttaagctggaattgtcccac
aataagctgaagcaactaccagagagcataggttctctcttctcactcagggagcttgtc
atctacagcaatgaccttcatatgatcccacattgtctgaaaaatcggcctttgctgaaa
atagatgtgcgtgacaatcctttgggacaacctcccatccacccccctctccctcccaca
cctgatcatgcagaagcaaaagttctggagttgcaccttggatataatcagcacagtttc
tgtgtttcgcctgctgggtgtcatgtgtttctcccaggaggggctgagctgctgttcccc
ccagggtgtctagagacagccacaaggctggagtgggttgagaaaaggccagaaaggaag
tgggtgtggctggaggagcatgaaatcctactgagtcgccctctggaacttcgtccccat
ggaattacatttataaagccagtggaggtgtgtgtgccctatcgtcggacaaaacgtagg
caggtggttgtgcggaggtttgatggacagtcatggagcactctgcccactgatctgagg
agaggaagcgatagccatagcagtcaccctgggggacgtccggccaggctggcatgctgc
tcagtgagccagttctcctggtttatggcagtgtcccatccagtgaaggacagctgctct
gttacaccagctggagcactgctggtgtccagctctgaccccggaatcaagctccacttc
cctccagactccaccgtgcagactcgcaccattattttacaggtgctgcaggtgtccgtg
tcagaggtacaggcagtgtgtggtgatcctcaggccagagtcagccctctcctttgcctc
tcccagactcccagcacacatttcctgcagcctatcaaagttcagatccctctgccatct
ggagttacaggccatacagttgatatgtcctgtttgcatctgctgcatggagaccccgct
gcccagacctggactgacatcacatcacaagtgtccctttatgtcacccatttgtatgcc
attttctacgttacacatttctcctggtactggctctggtacactactcagcgctgtgtt
agtggggtggtcaggaaggtctaccaacggctaaaacaatttaaagtccagttccttgtc
ctccagcgaaggactgatgcttctcaagttctgctgcagtgtttacctgctaacaagcaa
ttgtga

DBGET integrated database retrieval system