KEGG   Monopterus albus (swamp eel): 109951230Help
Entry
109951230         CDS       T05607                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109951230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:malb01002]
    109951230
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109951230
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109951230
Peptidases and inhibitors [BR:malb01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109951230
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109951230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 109951230
NCBI-ProteinID: XP_020441251
LinkDB All DBs
Position
Unknown
AA seq 279 aa AA seqDB search
MEKEEYGHTFDWSQKDEDVLGVEWMEADFIYDICLDNAQERIVGGYAPVPHSIKYIVSIQ
TLDRQHFCGGSLINKYWVITAAHCDRGINKMLIVVGDYSLTIYEGTEQEIMPQLLLPHPE
YNSTTNNDDIMLIKLRAPVYLNSYVSIALLPRHGASIVQGTVCRVSGWGYTSPTGSQIPS
TLRTVKLPIVSTEKCNSSESYHGEITENMLCAGYSTGGKDSCQGDSGGPLVCEGRVYGVV
SWGRGCAEAQFPGVYTAVSKYRSWIDNTIFSFYRGCNKG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaggaatatgggcatacatttgactggagtcaaaaagatgaggatgtttta
ggtgtagaatggatggaggctgattttatctatgatatttgtctagacaatgcacaggaa
cgcatagtgggaggatacgcaccagtcccacattcaatcaagtacattgtgtcgattcag
acactagaccgccagcacttctgcgggggctccttgataaataagtattgggtgatcaca
gcagcacactgtgaccgaggcataaacaaaatgttgatagtagtaggagactactctctg
accatctatgagggcacagaacaagaaatcatgccccagcttttgttgccccaccccgag
tacaacagcaccaccaacaacgatgacattatgctcataaagctgagggctccggtctac
ctgaacagctatgtttccattgccctgctacccaggcacggcgcctccatagtgcagggc
acagtgtgccgagtgtcaggctggggatacaccagccccactggaagccagatcccttcc
accctccgtactgtcaagctccccattgtctccacagaaaaatgcaacagcagtgagtcc
tatcacggtgaaatcacagagaacatgctgtgtgctggttacagtactggtggaaaggat
tcctgccagggggactctgggggtccgctggtttgtgaaggccgtgtctacggcgtggtg
tcctggggcagaggttgtgctgaagcccagtttcctggagtctacactgctgtctctaag
taccgcagttggatagataacaccatatttagcttctacagagggtgtaacaaaggttag

DBGET integrated database retrieval system