KEGG   Monopterus albus (swamp eel): 109951232
Entry
109951232         CDS       T05607                                 

Gene name
ccnb2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2 isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109951232 (ccnb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109951232 (ccnb2)
   04114 Oocyte meiosis
    109951232 (ccnb2)
   04115 p53 signaling pathway
    109951232 (ccnb2)
   04218 Cellular senescence
    109951232 (ccnb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109951232 (ccnb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109951232 (ccnb2)
   03036 Chromosome and associated proteins [BR:malb03036]
    109951232 (ccnb2)
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109951232 (ccnb2)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109951232 (ccnb2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C VbhA
Other DBs
NCBI-GeneID: 109951232
NCBI-ProteinID: XP_020441253
LinkDB
Position
Unknown
AA seq 390 aa
MSSVAVRAVQLPPTENPGKMGKTTTAVRRAALGERTNFPGAAVNTKRTGPAKASAKPSCD
LKVNASAVVPPVVQVQAPADPLPSVSEESADASMEEELCQAFSEALLTVQDVDEQDADLP
QLCSEYVKDIYNYLLDLEVQQAIRPNYMEGYEISERMRALLIDWLVQVHARFQLLPETLY
LTVAILDRFLQVQPVSRRKLQLVGVTAMLVACKYEEMYAPEVGDFAYITDNAFSKSEIMK
MEQLVLKSLNFQLGRPLPLHFLRRASKVANCDVERHTLAKYLMELTLLDYDMVHYRPSEI
AAASLCLSQLLLNGLPWSATQQHYSTYDEAHLKPVMQHIAKNVVTLNEGKTKFQAVKTKY
SSSKLMKISLIPQLKSSTIKSMAAPLLGSH
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgtcgtctgtggccgttcgtgctgtgcagctcccacccacagagaacccagggaagatg
ggtaaaaccacaacagctgtgaggagagctgctcttggagagagaaccaactttccagga
gcagcagtcaacacaaagaggactggaccagccaaagcatcagccaaaccatcttgtgac
ctaaaagtaaatgccagtgcggtggtgcctccagtagtccaggtccaagcacctgcagat
cctctcccttcagtttcagaggagtcagctgatgcctccatggaggaggaactctgccag
gctttctctgaggcgctgctcactgtgcaggatgtcgacgagcaggacgcagacctgcca
cagctctgctccgaatatgtcaaagacatctataattatctgctagacctggaggtgcag
caggctatacgcccaaactacatggagggttatgaaatcagtgaacgcatgcgagctctt
ctgatcgactggctggtccaagtgcacgccaggttccagctgctgccggagactctgtac
ctcacagttgccatcctggaccgttttctgcaggtccagccagtctctcgcagaaagctg
cagcttgttggtgtcactgccatgctggtggcctgtaaatatgaggagatgtacgctcca
gaagtcggcgactttgcctacatcacagacaatgcattttcaaagtctgagattatgaag
atggagcagctggttttgaagagccttaattttcagctgggacgtcctcttccattacac
ttcctcaggcgggcttcaaaggtggctaattgtgatgtagagagacacacgctggccaag
tatctgatggagctgaccctcctcgactatgacatggtgcactaccggccctctgagatt
gctgctgcttccctgtgtctctcccagctgctgcttaacgggctgccgtggtcggctaca
cagcagcactactctacttatgatgaggcccacctgaagccagtcatgcagcacattgcc
aaaaatgttgtgactttaaatgaggggaaaacaaagttccaggctgtgaagaccaagtac
tccagcagtaagctgatgaagatcagcctcattcctcagctgaagtcgtcaaccatcaag
agcatggcagctcctctgctcggcagtcactga

KEGG   Monopterus albus (swamp eel): 109951260
Entry
109951260         CDS       T05607                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2-like
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109951260
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109951260
   04114 Oocyte meiosis
    109951260
   04115 p53 signaling pathway
    109951260
   04218 Cellular senescence
    109951260
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109951260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109951260
   03036 Chromosome and associated proteins [BR:malb03036]
    109951260
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109951260
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109951260
SSDB
Motif
Pfam: Cyclin_N Cyclin_C VbhA
Other DBs
NCBI-GeneID: 109951260
NCBI-ProteinID: XP_020441304
LinkDB
Position
Unknown
AA seq 371 aa
MSSVEIRAVQLPPAENPGKMGKTTAAARRAALGEITNFPGAAVNTKRAGPSKSSAKSSCD
LNAKRSAVVPPVVQVQAPAELLSPVLEESADASMKEEELPQAFSEALLIVHDVDKQDADL
PQLCSEYVKDIYNYLHDLEVQQAIRPNYMEGYEISERMRALLIDWLVQVHARFQLLPETL
YLTVAILDRFLQVQPVSRRKLQLVGVTAMLVACKYEEMYAPEVGDFAYITDNAFSKSEIL
EMGQLVLKSLNFQLGRPLPLHFLRRASKVANCDVERHTLAKYLMELTLLDYDMVHYRPSE
IAAASLCLSQLLLNGLPWSATQQHYSTYDEAHLKPVMQHIAKNVVTLNEGKTKFQELVQV
VAIVISLVSKS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgtcgtctgtggaaattcgtgctgtgcagctcccacccgcagagaacccagggaagatg
ggtaaaaccacagcagctgcgaggagagctgctcttggagagataacaaactttccagga
gcagcagtcaacacaaagagggctgggccatccaaatcatcagccaaatcatcttgtgac
ctaaatgcaaaacgcagtgcagtggtgcctccagtagtccaggttcaagcacctgcagag
ctactctctccagttttagaggagtcggctgatgcgtccatgaaggaggaggaactgccc
caggctttttctgaggcgctgctcattgtgcatgatgtcgacaagcaggacgcagacctg
ccacagctctgctccgaatatgtcaaagacatctataattatctgcatgacctggaggtg
cagcaggctatacgcccaaactacatggagggttatgaaatcagtgaacgcatgcgagct
cttctgatcgactggctggtccaagtgcacgccaggttccagctgctgccggagactctg
tacctcacagttgccatcctggaccgttttctgcaggtccagccagtctctcgcagaaag
ctgcagcttgttggtgtgactgccatgctggtggcctgtaaatatgaggagatgtacgct
ccagaagtcggcgactttgcctacatcacagacaatgcattttcaaagtctgagattctg
gagatggggcagctggttttgaagagccttaattttcagctgggacgtcctcttccatta
cacttcctcaggcgggcttcaaaggtggctaattgtgatgtagagagacacacgctggcc
aagtatctgatggagctgaccctcctcgactatgacatggtgcactaccggccctctgag
attgctgctgcttccctgtgtctctcccagctgctgcttaacgggctgccgtggtcggct
acacagcagcactactctacttatgatgaggcccacctgaagccagtcatgcagcacatt
gccaaaaatgttgtgactttaaatgaggggaaaacaaagttccaggagttggtgcaagtt
gtggcaatagtcatttcacttgtctcaaagtcatag

KEGG   Monopterus albus (swamp eel): 109968695
Entry
109968695         CDS       T05607                                 

Gene name
ccnb1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1 isoform X1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109968695 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109968695 (ccnb1)
   04114 Oocyte meiosis
    109968695 (ccnb1)
   04115 p53 signaling pathway
    109968695 (ccnb1)
   04218 Cellular senescence
    109968695 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109968695 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109968695 (ccnb1)
   03036 Chromosome and associated proteins [BR:malb03036]
    109968695 (ccnb1)
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109968695 (ccnb1)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109968695 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109968695
NCBI-ProteinID: XP_020470812
LinkDB
Position
Unknown
AA seq 395 aa
MALRVTRNRLASTRTDLGGKACSVTGPTGKPRAALGEIGNIAANKEAQKKNVKMEATKKT
KVTKVEKAAVEKPKDVPKPEVKVLPEPASPTPMETSGCEPADLCQAFSDVILNTAIRDVD
AGDHDNPMLCSEYVNDIYKYLRQLEAEQSVRSSYLQGQEVTGNMRAILIDWLVQVSLKFR
LLQETMYMTVGIIDRFLQDHPVPKKQLQLVGVTAMFLASKYEEMYPPEISDFAYVTDKAY
TTAQIRDMEMTILRMLKFQLGRPLPLQFLRRASKVAEVTAEQHTLAKYLLELTMVDYEMV
HFPPSMLASAALALTLKILDAGEWDATLLHYMDYTAESLIPAMAHIAKNVVKVNDGLTKH
LAIKGKYSTSKQMRIATIPQLKSLLVKDLAKQLAQ
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggctcttcgagtaacaagaaaccgcttggcttcgaccaggactgacctcggtggaaag
gcctgctcagttaccgggcccacagggaagcctcgggcggcgcttggtgaaatcggaaac
atcgcagctaacaaagaagcccagaagaagaatgttaagatggaggccactaagaagacc
aaagtcacaaaagtggaaaaagcagctgttgaaaaaccaaaagatgttcctaaacctgag
gtgaaggttctgcctgaaccagcatcacccactccgatggagacatctggctgtgagcct
gctgacctctgtcaagcgttttcagatgttatactaaatactgctatcagggatgtggat
gcaggtgaccatgacaacccaatgctctgcagtgaatatgtgaatgacatctacaagtac
ctccgacagcttgaggctgagcagagtgttagatccagttatctgcagggccaggaggtg
acgggtaacatgcgagccattctcattgactggctagtgcaagtgagcctgaagttccgt
ctgctgcaggagaccatgtacatgactgttggaatcattgaccgctttcttcaggaccac
ccagtccccaagaagcagctgcagttagtcggtgttacagccatgttccttgcatccaaa
tatgaagagatgtatcccccagagatctcggactttgcatatgtgacagacaaggcttac
accactgcccagatcagagacatggagatgacaatcttgcggatgcttaagttccagcta
ggccgccctcttcccctgcagttccttagaagggcctcaaaggttgctgaggtaactgct
gagcagcacaccctggcaaagtacctcctggagctcaccatggttgattatgaaatggtt
catttcccaccttccatgttggcaagtgctgcgttggctctcaccctcaagatcttggat
gctggagaatgggatgcgacactgctgcactacatggactacactgcagagagtttgatt
cctgcgatggcacatattgccaagaatgttgtcaaagtgaatgatggactgaccaagcac
ctggccatcaaaggtaaatactctacttcaaagcagatgaggattgccaccatcccacag
ctgaagtctttactggtgaaggacctagcaaagcagctcgcccagtga

DBGET integrated database retrieval system