KEGG   Monopterus albus (swamp eel): 109951253
Entry
109951253         CDS       T05607                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109951253
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109951253
   04090 CD molecules [BR:malb04090]
    109951253
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109951253
  Exosomal proteins of other body fluids (saliva and urine)
   109951253
  Exosomal proteins of colorectal cancer cells
   109951253
CD molecules [BR:malb04090]
 Proteins
  109951253
SSDB
Motif
Pfam: Tetraspanin IBD
Other DBs
NCBI-GeneID: 109951253
NCBI-ProteinID: XP_020441289
LinkDB
Position
Unknown
AA seq 255 aa
MGKGCITATKYFLFLFNLIFFLFGVVIMGFGLWLLLDSQSFIVVLSNSTPVKVACYILIG
VGAFSMLMGFLGCLGAIYEIRCLLGLYFTCLLLILAAQITAGVLIYYQKDVLNEEMSKIV
TKVLDNYPGNNSTTEQAWDFIQRNMKCCGWSGRLDWTDNMVIVNSSQLLFPCSCHNTSLA
NGNFSDSGFCEAHTPDWPVYDGGCADSVENWILTNIGVVLGICLGVALVELLGMILSLCL
CKNIHVEEYTKVPKY
NT seq 768 nt   +upstreamnt  +downstreamnt
atgggaaaaggctgcataacagcgaccaagtacttcctgtttctcttcaacctcatcttc
tttctgtttggggtcgtcatcatgggatttggattgtggctcctccttgacagtcagagc
ttcatcgtcgtcctaagtaattccacacctgttaaggtagcctgctacatcctgatcgga
gtcggagctttctccatgctcatgggcttcctcggctgcttgggggccatttatgagatc
cgctgcctgcttggcctgtatttcacctgcctcctgctaatcctcgcggctcagataaca
gcaggtgttctcatctactaccagaaggacgtgttaaatgaggagatgtccaagatcgtc
accaaggtactcgacaactaccctggcaacaactcaaccacagagcaggcctgggacttc
atccagaggaatatgaagtgctgtggctggagcggtcgtctggactggactgataacatg
gtcattgtcaacagctcccagctgctgtttccctgctcctgccataacacctctctcgcc
aatggaaacttctccgacagtggattctgtgaggcgcacacacccgactggcccgtatac
gatgggggttgtgctgacagtgtggagaactggatcctcaccaacatcggggtcgtcctg
ggtatctgcctcggagtggctcttgttgagctgctgggcatgatcttgtctctctgtctg
tgcaagaacattcatgtggaggagtacaccaaagtgcccaagtactaa

KEGG   Monopterus albus (swamp eel): 109970861
Entry
109970861         CDS       T05607                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109970861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109970861
   04090 CD molecules [BR:malb04090]
    109970861
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109970861
  Exosomal proteins of other body fluids (saliva and urine)
   109970861
  Exosomal proteins of colorectal cancer cells
   109970861
CD molecules [BR:malb04090]
 Proteins
  109970861
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 109970861
NCBI-ProteinID: XP_020474368
LinkDB
Position
Unknown
AA seq 305 aa
MKLQLKIQLLKFCSAVFNSIFLVLGLSVAGCAIWILFDTENLLAFLSSEELCTVAFTLLV
IGGVVMVVSVVGCVGAEGKHRFLLLVYLGALIVLILGQLFVALLLLINRNKIEQTLGEVV
DQIIFDYGGNSTDRLLDRVQRYGQCCGRTGPSDWLKNSYIQSLNLTDLNILPCSCFIRNR
PSMTLSWCSELVNFTEPLYKQGNSSYTEGCQQKLSDWLQENGLTVIGMDLSLILIQVVQV
AVAVYLYQAFGRKASLKKSNRLAGLDHAPDEDLDSSEQMPDDAYLDPNYPECYPENTNLG
FHHED
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagctgcaattgaagattcagctgctgaagttctgctctgcagtttttaactccatc
ttcctggttctgggtctgagtgtcgctggctgtgcaatctggatcctgtttgacacagaa
aatctcctggccttcctctcatccgaggagctgtgtacagtggcattcacgctgctggtg
attggtggagtggtgatggtggtcagtgttgttggatgtgtaggagctgagggaaagcac
aggttcctgctgctggtgtacctgggcgccctcattgtcctgatcctgggtcaactgttc
gttgcactgctgctgctcataaacaggaacaagattgaacaaactctgggtgaagtggtg
gatcagatcatctttgattacggaggaaacagtacggacagactgttggaccgggtgcag
cgctacgggcagtgctgtggcaggacagggccttctgattggctgaagaactcttacatc
cagagtctgaacctgaccgatctcaacatacttccctgttcctgtttcatcaggaatcgt
cccagcatgaccttgtcctggtgctccgagcttgtgaacttcactgagccgctgtacaaa
caaggaaacagctcgtatacggagggctgccaacagaaactcagtgattggctgcaggag
aacggcctaacagtcatcggcatggacctcagtctcatattgatccaggtggtgcaggtt
gctgtagcagtgtacctgtaccaagcattcggcagaaaagcctctttgaagaaaagcaat
cgcctggctggccttgaccacgcccctgatgaagacctggactcctcagagcagatgcct
gatgatgcttatttagaccccaactacccagaatgctaccctgagaacacaaacttgggt
tttcaccatgaggactag

KEGG   Monopterus albus (swamp eel): 109972994
Entry
109972994         CDS       T05607                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109972994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109972994
   04090 CD molecules [BR:malb04090]
    109972994
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109972994
  Exosomal proteins of other body fluids (saliva and urine)
   109972994
  Exosomal proteins of colorectal cancer cells
   109972994
CD molecules [BR:malb04090]
 Proteins
  109972994
SSDB
Motif
Pfam: Tetraspanin TadF UFC1
Other DBs
NCBI-GeneID: 109972994
NCBI-ProteinID: XP_020477936
LinkDB
Position
Unknown
AA seq 235 aa
MGKGCITVTKYFLFLFNLLFFIFGALIMGFGLWVLLDNQSFIAVLQESSETVKVTSYILI
GVGSLSMAMGFFGCIGAIYEIRCLLGLYFTCLLLILIAQVTAGVLIYFQRDRLKYEMSII
IKDMIINYTGQNRTTEQAWDYIQSTMKCCGWTGPGNWSENLLIKNSSQKFYPCSCRNVSL
PGTEIKPGGLCEALSTDLPVFETGCITSVEKWLLDNCGVILGICFGVVVVELLGM
NT seq 705 nt   +upstreamnt  +downstreamnt
atggggaaaggatgcatcacagtcaccaagtactttctcttcctcttcaaccttcttttc
tttatctttggcgcattgatcatgggctttggactgtgggttctccttgataaccagagt
ttcattgcggttctacaggaatcatcagaaacagtgaaggtgacttcctacatcctcatc
ggtgtgggttctttgtcaatggccatgggcttcttcggctgtataggagccatatatgaa
atccgttgtctgctgggactgtacttcacctgtctcctgctcatcctcatcgcccaggtc
actgctggagttcttatttacttccagagagatcggttgaaatatgaaatgtccatcatc
ataaaggacatgataatcaactacaccggccagaacaggaccacagagcaggcctgggac
tacattcagagtacaatgaagtgctgtggctggactggtccaggaaactggtctgagaat
cttttgatcaagaacagctcccagaaattctacccatgttcctgtcgcaatgtgtccctg
cctggcaccgaaatcaagccaggaggcctgtgcgaagccttgtccacagacttacccgtc
tttgaaacgggctgtataaccagtgtggagaaatggctcctggacaactgtggagttatt
ttgggaatctgttttggtgtggtagtcgtggagctcctcgggatg

DBGET integrated database retrieval system