KEGG   Monopterus albus (swamp eel): 109951400
Entry
109951400         CDS       T05607                                 

Gene name
tp53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04137  Mitophagy - animal
malb04210  Apoptosis
malb04216  Ferroptosis
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109951400 (tp53)
   04310 Wnt signaling pathway
    109951400 (tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109951400 (tp53)
  09143 Cell growth and death
   04110 Cell cycle
    109951400 (tp53)
   04210 Apoptosis
    109951400 (tp53)
   04216 Ferroptosis
    109951400 (tp53)
   04115 p53 signaling pathway
    109951400 (tp53)
   04218 Cellular senescence
    109951400 (tp53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109951400 (tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109951400 (tp53)
   03036 Chromosome and associated proteins [BR:malb03036]
    109951400 (tp53)
   03400 DNA repair and recombination proteins [BR:malb03400]
    109951400 (tp53)
Transcription factors [BR:malb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109951400 (tp53)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109951400 (tp53)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109951400 (tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TFIIE-A_C
Other DBs
NCBI-GeneID: 109951400
NCBI-ProteinID: XP_020441547
LinkDB
Position
Unknown
AA seq 374 aa
MMDEQSFDSLQLCQELPLSQDSFSVLWENVVTPPISTIPTVPFETNEPMNMMFSDEHALP
QGFENLFDMTSELLPKEGITPPFSNGPVTSDYPGEYGFKLRFQNSGTAKSVTSTFSEVLN
KLYCQLAKTSLVEVLVTQEPPQGAIIRATAVYKKTEHVAEVVRRCPHHQNEDVVAHSSHL
IRVGGSQGALYFEDPHTKRQSVTVPYEPPQPGSEMSTILLRFMCNSSCMGGMNRRPILTI
LTLETKEGLVLGRRCFEVRICACPGRDRKSEEENKSNQQSGTKQTKKRKSAPAPGTTSSK
KTKSASSAEEEEKEVFVLHVQGRERFEMLKKINDALELHDKENKSKSRVPAKQELPLPIN
GKKLLQRGEKSDSD
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgatggatgagcaaagttttgacagcctgcagttgtgtcaggaactgccgctgagccag
gactccttcagcgtgctgtgggagaatgtagtaactccccccatctccacaatcccaaca
gtgccttttgagacaaacgaaccaatgaatatgatgttcagtgatgagcatgcactacct
caggggtttgagaatctgtttgacatgacctctgagctgttacctaaagagggcattact
cctccattctccaatggcccagttacatccgactaccctggggaatatggcttcaagctt
cgctttcagaactctggcacggccaagtcggtcacttccactttttcagaagttctcaac
aagctatattgtcagctggcaaagaccagccttgtggaagtgctggtgacccaggaacct
cctcagggtgccattatcagggccacagcggtttacaagaagactgagcatgtggccgag
gtggtccgcagatgcccccatcaccagaatgaggatgttgtagcgcatagcagccacctg
atcagagtcgggggcagccagggagctctgtattttgaggatcctcacacaaagagacag
agtgtgactgtcccttatgagcccccccagccgggctcagagatgtcaaccatcctgctg
aggttcatgtgcaacagctcctgcatggggggcatgaaccgcagacccatcctcaccatt
ctgaccctcgagactaaagagggactggttttgggtcgccgttgctttgaggtccgtatc
tgtgcatgtccaggcagggaccgcaaatctgaggaggaaaacaaaagtaatcagcagagt
ggcaccaaacagactaaaaaacgcaaaagtgccccagctcctggcacgacttcttcaaag
aagactaagtctgcctccagtgcagaggaggaggagaaggaggtctttgttctccatgtt
cagggtcgtgagcggttcgagatgttgaagaaaatcaatgacgctctggagctgcatgac
aaagaaaacaaatctaagtccagggtcccagcgaagcaggagcttcctctgcccatcaat
gggaagaaactgctgcagagaggagagaagagtgacagcgactga

DBGET integrated database retrieval system