KEGG   Monopterus albus (swamp eel): 109951840Help
Entry
109951840         CDS       T05607                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00010  Glycolysis / Gluconeogenesis
malb00051  Fructose and mannose metabolism
malb00052  Galactose metabolism
malb00500  Starch and sucrose metabolism
malb00520  Amino sugar and nucleotide sugar metabolism
malb00524  Neomycin, kanamycin and gentamicin biosynthesis
malb01100  Metabolic pathways
malb01200  Carbon metabolism
malb04910  Insulin signaling pathway
Module
malb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
malb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109951840
   00051 Fructose and mannose metabolism
    109951840
   00052 Galactose metabolism
    109951840
   00500 Starch and sucrose metabolism
    109951840
   00520 Amino sugar and nucleotide sugar metabolism
    109951840
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109951840
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109951840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109951840
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109951840
Membrane trafficking [BR:malb04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109951840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109951840
NCBI-ProteinID: XP_020442215
LinkDB All DBs
Position
Unknown
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDQNKKIDKYLYSMRFSDETLKDIMNRFRRDMENGLCRDTNPTAS
IKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTRDKKQPVQMESQVYETPDDIIH
GSGTQLFAHVADCLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSVNPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKTKEGVKKCMEILTRLG
VEPSEEDCLAVQHVCTIVSFRSANLISATLGAILSRLKDNKGVARLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSAKGAAMVTAVAYRLTEQARHIQQTLAEFRLT
KAQLLEVKKRMRVEIERGLKKSTHKEATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRSVEMHNKIYAIPIEAMTGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCYQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKEEFELDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIEIVEENEGRMCVNMEWGAFGDNGCLDD
IRTKYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGYLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFCRIFQLTVKELAPKCDVTFLLSEDGSGKG
AALITAVGCRQRELDAQQH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctcagcttctggcctactacttcaccgagctgaaggatgatcaaaataaa
aagatcgataagtacctgtactccatgcgtttctcagacgaaacgctgaaggacatcatg
aacaggttccggcgagatatggagaacgggctctgccgtgacaccaaccccaccgcctcg
atcaagatgctgcccaccttcgtcaggtccatccctgatggatcagaaaagggagacttt
atagctctggacctcggggggtcgaactttcggatactccgtgtgaaggtaacgcgggac
aagaagcagccggtccagatggagagccaggtttatgagacccctgatgacatcatccat
gggagcgggacacagctctttgcccatgtagccgactgcctgggcgacttcatggagaag
caaaaaatcaaggataaaaagcttcctgtaggatttacattctccttcccctgtgcacaa
accaaactggatgaggcagtcttactgacatggacaaagaggtttaaagccagtggcgtg
gaaggcatggatgttgtgaagcttctgaacaaggccatcaagaaacgaggggactacgag
gcagacatcatggcagtggtgaatgacacggtcggcaccatgatgacctgtggatttgat
gatcagcgctgtgaagtgggcatcattataggaacaggaacaaatgcctgctacatggag
gaactgcgtcacattgacctggtggaaggagacgaaggccggatgtgcatcaacactgag
tggggtgcctttggggatgatgggtccctggaggacattcgcacagagtttgaccgtgag
atcgacaggggttctgtcaatccaggaaagcagctgtttgagaagatggccagtgggatg
tacatgggggagctggttcggctcatcctggtcaagatggccaaagagggtctgctgttt
gagggacggataacccccgagctcctgacgaaaggaaagattgagacaaaacatgtctct
gctattgaaaagacgaaggaaggggtgaagaaatgtatggaaatcctgacgaggctcggg
gtggagccttcagaggaagactgtctggcagtgcagcacgtgtgcaccatcgtttccttc
cgctcagcaaatctaatttctgcaaccctgggagctatcctctctcggctcaaggacaac
aaaggagtcgcacgcctccgcaccaccgtgggcatcgacgggtctctctacaagatgcac
cctcaatacgctcggcgtctgcacaagacagtccgtcgcttggtcccagactccgatgtc
cgcttcctcctgtccgagagcgggagtgcgaaaggcgcagccatggtgacagcagtggcc
taccgtctgacggagcaggcgcgacacattcagcagactctggctgagttccgactgacc
aaagcccagttgttggaggtgaagaagcgaatgagggtggaaattgaaagaggcctcaag
aagagtactcacaaggaagctacagttaagatgttgcccacctttgtccgcagtacacca
gatggaactgagaacggcgatttccttgctctggaccttggcgggacaaacttccgtgtg
ctccttgtaaagattcgcagcgggaagaggcgatcagtggagatgcacaacaaaatctac
gcgattcccatagaagctatgacaggcacaggcgaagagctctttgaccacattgtacac
tgcatctctgacttcctggactacatggggatgaaaagcgctcggctgccacttggtttc
accttctccttcccctgctatcagaccagcctggacgcaggtattctggtaacctggacc
aaaggcttcaaggctacagactgtgagggcgaagatgtggtggagcttcttcgggaagca
attaagaggaaagaggagtttgagctggatgtggttgccatagtgaacgacacagttgga
acaatgatgacctgtgcatatgaggaacccacctgtgaggttggcctgattgcagggacg
ggaagcaacgcctgctacatggaggagatgaggaacattgagatagtggaggaaaacgag
ggccgcatgtgtgtcaacatggagtggggggcctttggagacaacggctgtctggatgac
atcaggacaaagtacgaccaggcggtggacgagaactcgctcaacgaaggcaaacaaaga
tatgagaagatgtgcagcggcatgtacctgggagagatcgtcaggcagattttgatcgat
ctgaccaagcgtggctacctatttcggggacaaatctcagagacgctgaagaccaggggc
atctttgagacaaagttcctttcgcagatagagagtgatcgtctggcgctgctgcaagtc
agggcgattctgcagcagctggggctcgacagcacctgtgatgacagtattatcgtgaag
gaagtgtgtggcacggtgtcccgccgtgcggctcagatctgcggagccggaatggctgct
gtggtggacaagatccgtgagaacagaggactggaccacctggacattaccgtgggcgtg
gatggcacactctacaagttgcacccacacttctgtaggatcttccagctgacagtgaag
gaacttgcccccaaatgtgacgtcaccttcctgctctccgaggacggcagcgggaagggg
gctgccctcatcactgccgtgggctgccgtcagagggagctggacgcgcagcagcactga

DBGET integrated database retrieval system