KEGG   Monopterus albus (swamp eel): 109952067
Entry
109952067         CDS       T05607                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109952067
   04068 FoxO signaling pathway
    109952067
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109952067
   04210 Apoptosis
    109952067
   04115 p53 signaling pathway
    109952067
   04218 Cellular senescence
    109952067
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109952067
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109952067
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109952067
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109952067
NCBI-ProteinID: XP_020442580
LinkDB
Position
Unknown
AA seq 153 aa
MVPDESFVSIENRMQSVGLALEELLVTAQKQDCLTIGIYESAKLLNVDPDSVVLCVVAAD
DKDDVALQIHFTLLQSFCLDSDITILRVSGIQRLQQLLGAANTKRNQEEHGDFHCILVTN
PQADHCRLQEVGTYCQESRRLHQWVAELVLQER
NT seq 462 nt   +upstreamnt  +downstreamnt
atggttccagatgaaagctttgtgtccatcgaaaacaggatgcagtcggtaggtctggct
ctggaggagttgctggtgacagctcagaaacaagactgcctaactattggcatctatgaa
tctgctaagcttcttaatgtagatccagacagtgtggtcctgtgtgtcgtggcagccgat
gacaaagatgatgtggcgctgcagatccatttcaccctgttacagtcattctgtctcgac
agcgacatcaccatcctacgagtctcagggattcagcggctccagcagttgctgggagca
gcgaataccaagagaaaccaggaagagcatggcgactttcactgcatactggttacgaac
cctcaggctgaccactgcaggctgcaggaggtgggcacctactgccaggaaagccggcgt
cttcaccagtgggtagctgaactggtcctgcaggaacgctga

KEGG   Monopterus albus (swamp eel): 109954145
Entry
109954145         CDS       T05607                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109954145
   04068 FoxO signaling pathway
    109954145
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109954145
   04210 Apoptosis
    109954145
   04115 p53 signaling pathway
    109954145
   04218 Cellular senescence
    109954145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109954145
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109954145
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109954145
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109954145
NCBI-ProteinID: XP_020445204
LinkDB
Position
Unknown
AA seq 109 aa
LYSDPDSVSFCVLAMDEEFECDIALQIHFTLIQSFCFDNDISIVRVSDMQRLAEIVGDKA
EQLEDAHCVLITNPAEGSWEDPALEKLHLFCEESRRLNDWVPEISLPER
NT seq 330 nt   +upstreamnt  +downstreamnt
ctctacagtgatccggacagtgtgtctttctgcgtcctggccatggatgaggagtttgag
tgtgacatcgctctccagatccacttcaccctcatccagtccttctgcttcgacaacgac
atcagcatcgtgagagtgagcgacatgcagcgtctggctgagattgttggtgacaaggcc
gagcagcttgaagacgcccactgtgtcctcatcacgaacccagctgaagggtcttgggag
gaccctgctctagagaagctgcacctgttctgcgaggagagccgccgcctgaacgactgg
gttcctgagatcagcctccccgagcgttga

KEGG   Monopterus albus (swamp eel): 109956503
Entry
109956503         CDS       T05607                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109956503
   04068 FoxO signaling pathway
    109956503
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109956503
   04210 Apoptosis
    109956503
   04115 p53 signaling pathway
    109956503
   04218 Cellular senescence
    109956503
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109956503
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109956503
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109956503
SSDB
Motif
Pfam: Ribosomal_L7Ae Sial-lect-inser
Other DBs
NCBI-GeneID: 109956503
NCBI-ProteinID: XP_020449318
LinkDB
Position
Unknown
AA seq 267 aa
MNKHWRVSNTTFIGHASKIWDNQEIKSHLGQDRCSLQTVVSSVILGELKGRALLSNGRNK
SGTDRPLPRNSADLLYNHPLSVPSKTHHTEQRNLVCSLQDPDNAWIITMTLEEISGQENT
MENADRVQNAGAALEELLVAAKEQDYLTVGVYESAKVMNVDPDSVAFCVLATDEEYESDI
ALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGANETGEPKDAHCILVTSPCANPWKDP
ALDKLGLFCEESHSVYDWVPAITLPER
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaacaaacactggcgtgtgtcgaacacaacctttattggtcacgcatccaaaatatgg
gacaatcaagaaattaaatcccatttggggcaggacaggtgtagcctacagactgtagta
agctctgtcatcctcggggaactgaagggtcgagctttattgtccaatggtaggaacaag
agcggaacagaccgccccttgccgagaaactccgctgacctactatataaccacccactg
tctgttccgagcaagacacatcacacagagcaacgcaaccttgtctgttcactgcaagat
cccgataacgcttggattataactatgactctggaggagatcagcggacaagagaatacg
atggaaaacgcagatagggtgcaaaatgcaggcgcagccctggaagagctgctggtcgct
gcaaaggagcaagactacctgacagttggagtttatgaatctgctaaagtcatgaatgtt
gacccagacagcgtagcgttctgcgtcctcgccaccgatgaggaatacgagagtgacatc
gctcttcagatccacttcaccctcatccaggctttctgtttcgacaacgacatcaacgtg
gtgcgcgtcaatgacatagagcgtctggccgacctcgtgggcgcaaacgagaccggcgaa
cccaaggacgcgcactgcattcttgtcacgagtccctgtgcaaatccatggaaggatcct
gctctggacaagctgggtttattctgtgaggagagccacagtgtgtacgactgggtgccc
gccatcacactgccagagcgctga

KEGG   Monopterus albus (swamp eel): 109965191
Entry
109965191         CDS       T05607                                 

Gene name
gadd45b
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109965191 (gadd45b)
   04068 FoxO signaling pathway
    109965191 (gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109965191 (gadd45b)
   04210 Apoptosis
    109965191 (gadd45b)
   04115 p53 signaling pathway
    109965191 (gadd45b)
   04218 Cellular senescence
    109965191 (gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109965191 (gadd45b)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109965191 (gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109965191 (gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae MnmE_helical
Other DBs
NCBI-GeneID: 109965191
NCBI-ProteinID: XP_020464673
LinkDB
Position
Unknown
AA seq 185 aa
MNTSLCALWIFLTILDLVDYFTDFSMTLEELVGSNSTEKKMETVSQALEELLVTAQRQDC
LTVGVYESAKLMNVDPDSVVLCVLATDEEDVDDIALQIHFTLLQAFCCDNDINILRVSGI
RRLAQLLGEDTENSNSNEPRDLHCILVTNPPVQPLQCQALQDINNFCEESRCRNQWVPCL
ELQDG
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaacaccagcctgtgcgcgctgtggatatttcttactatcctggatcttgtggattat
tttactgacttcagcatgactctggaggaactcgttggatccaacagcaccgagaaaaag
atggagacggtgagtcaggctctggaggagctgctggtcacagctcagcggcaagactgt
ctcacggtgggagtctacgaatccgccaaactcatgaatgtagacccggacagtgtggtc
ctgtgcgtcctcgccactgatgaggaggatgtcgatgacatcgcgctgcagatccacttc
acgcttctgcaggctttctgctgcgacaacgacattaacattctgcgggtgtccggcata
aggcggctggcccagctgctgggggaggacaccgagaacagtaacagcaacgagccccgg
gacctgcactgcatcctggtcacgaaccccccagtgcagccgctacagtgccaggccctg
caggacatcaacaatttctgtgaggagagccgctgcaggaaccagtgggtgccctgtctg
gagctgcaggacggctga

KEGG   Monopterus albus (swamp eel): 109965752
Entry
109965752         CDS       T05607                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109965752
   04068 FoxO signaling pathway
    109965752
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109965752
   04210 Apoptosis
    109965752
   04115 p53 signaling pathway
    109965752
   04218 Cellular senescence
    109965752
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109965752
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109965752
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109965752
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109965752
NCBI-ProteinID: XP_020465700
LinkDB
Position
Unknown
AA seq 157 aa
MCNMTFEETNGDNSSERMESVSKALEEVLSSALPQGCITVGVYEAAKALNADPDNVVLCL
LATDDEEDVALQIHFTLIQAFCCENDINILRVSNMRRLAEILGGVKPGGEPMDLHCVLVT
NPQSSLWKNPALSKVNRFCRDSRCLDQWVPVINLPDR
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtgcaatatgacttttgaagaaaccaatggagataattcttcagaaaggatggaatcg
gtgtctaaagcattagaggaggtcctgagctctgcattgcctcagggttgcatcactgtt
ggagtctatgaggcagcaaaggcactaaatgcggatccagacaatgtggtgttgtgcctg
ctggccacagacgatgaggaggatgtggctctccagattcatttcaccttaatccaggct
ttctgctgtgagaatgacatcaacatcctgcgggtgagcaacatgcggcgtctggcagaa
atcctgggtggggtgaaacctggaggggagcccatggacctgcactgtgttctggttact
aacccgcagtcatcactgtggaagaaccctgcactgagcaaagtgaacagattctgcaga
gacagtcgctgtttggatcagtgggtgcctgttatcaacctgcctgaccggtga

KEGG   Monopterus albus (swamp eel): 109969313
Entry
109969313         CDS       T05607                                 

Gene name
gadd45a
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109969313 (gadd45a)
   04068 FoxO signaling pathway
    109969313 (gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109969313 (gadd45a)
   04210 Apoptosis
    109969313 (gadd45a)
   04115 p53 signaling pathway
    109969313 (gadd45a)
   04218 Cellular senescence
    109969313 (gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109969313 (gadd45a)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109969313 (gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109969313 (gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109969313
NCBI-ProteinID: XP_020471754
LinkDB
Position
Unknown
AA seq 146 aa
MDSVAKALEEVLISALPQGCITVGVYEAAKSLNVDPDNVVLCILATDDEDVKDVALQIHF
TLIQAFCCENDINILRVNNTRRLAEILGGAGGGKQGGGEPMDLHCVLVTSPHSTSWKDPA
LSKVNRFCRESRCLDQWVPIINLPER
NT seq 441 nt   +upstreamnt  +downstreamnt
atggattcagtggcgaaagctttagaagaagttctcatctctgcgttaccacagggctgc
attacagtcggtgtctatgaggctgccaagtccctgaatgtagaccctgataatgtggtt
ttgtgcatcctggctactgatgatgaagacgtgaaagatgtggccctgcagattcacttt
accctcattcaggctttctgctgtgagaatgacatcaacatcctccgagtcaacaacacc
agacgcctggcagagatactgggtggagcaggaggtggaaaacagggtgggggtgaacct
atggacctccactgtgtcctggtcactagtccacattctacttcatggaaagaccctgct
ttgagcaaagtgaatcgattctgcagagagagccgctgtctggaccaatgggtacctatc
atcaacctgcctgaacgatga

KEGG   Monopterus albus (swamp eel): 109973653
Entry
109973653         CDS       T05607                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109973653
   04068 FoxO signaling pathway
    109973653
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109973653
   04210 Apoptosis
    109973653
   04115 p53 signaling pathway
    109973653
   04218 Cellular senescence
    109973653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109973653
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109973653
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109973653
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109973653
NCBI-ProteinID: XP_020479062
LinkDB
Position
Unknown
AA seq 154 aa
MTLEEVLIQKPIERTQCTGNALEEVLVSAKDNDSLTVGVYECAKVMNLDPDSVSFCVLAM
DEEFECDIALQIHFTLIQSFCFDNDISIVRVSDMQRLAEIVGDKAEQLEDAHCVLITNPA
EGSWEDPALEKLHLFCEESRRLNDWVPEISLPER
NT seq 465 nt   +upstreamnt  +downstreamnt
atgactctggaggaggttctgatccagaaacccatcgagcgtactcagtgcaccggcaac
gccctggaggaggtcctggtgtccgctaaagacaacgactccctcacagttggtgtatat
gaatgcgcaaaagttatgaatcttgatccggacagtgtgtctttctgcgtcctggccatg
gatgaggagtttgagtgtgacatcgctctccagatccacttcaccctcatccagtccttc
tgcttcgacaacgacatcagcatcgtgagagtgagcgacatgcagcgtctggctgagatt
gttggtgacaaggccgagcagcttgaagacgcccactgtgtcctcatcacgaacccagct
gaagggtcttgggaggaccctgctctagagaagctgcacctgttctgcgaggagagccgc
cgcctgaacgactgggttcctgagatcagcctccccgagcgttga

KEGG   Monopterus albus (swamp eel): 109973654
Entry
109973654         CDS       T05607                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109973654
   04068 FoxO signaling pathway
    109973654
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109973654
   04210 Apoptosis
    109973654
   04115 p53 signaling pathway
    109973654
   04218 Cellular senescence
    109973654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109973654
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109973654
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109973654
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109973654
NCBI-ProteinID: XP_020479063
LinkDB
Position
Unknown
AA seq 140 aa
MKSPGRSLKEALLCAQSEDRLTIGVYESAKIMTDDPDSVSFCVLAMDEEFECDIALQIHF
TLIQSFCFDNDISIVRVSDMQRLAEIVGDKAEQLEDAHCVLITNPAEGSWEDPALEKLHL
FCEESRRLNDWVPEISLPER
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaagtctccaggaagatctctgaaggaagctctgctctgtgctcagagcgaggatcga
ctcactataggggtttatgagagtgctaaaattatgactgatgatccggacagtgtgtct
ttctgcgtcctggccatggatgaggagtttgagtgtgacatcgctctccagatccacttc
accctcatccagtccttctgcttcgacaacgacatcagcatcgtgagagtgagcgacatg
cagcgtctggctgagattgttggtgacaaggccgagcagcttgaagacgcccactgtgtc
ctcatcacgaacccagctgaagggtcttgggaggaccctgctctagagaagctgcacctg
ttctgcgaggagagccgccgcctgaacgactgggttcctgagatcagcctccccgagcgt
tga

DBGET integrated database retrieval system