KEGG   Monopterus albus (swamp eel): 109952263
Entry
109952263         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00230  Purine metabolism
malb01100  Metabolic pathways
malb04020  Calcium signaling pathway
malb04114  Oocyte meiosis
malb04261  Adrenergic signaling in cardiomyocytes
malb04270  Vascular smooth muscle contraction
malb04371  Apelin signaling pathway
malb04540  Gap junction
malb04912  GnRH signaling pathway
malb04914  Progesterone-mediated oocyte maturation
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109952263
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109952263
   04020 Calcium signaling pathway
    109952263
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109952263
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109952263
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109952263
   04914 Progesterone-mediated oocyte maturation
    109952263
   04916 Melanogenesis
    109952263
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109952263
   04270 Vascular smooth muscle contraction
    109952263
Enzymes [BR:malb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109952263
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 DUF1053 OPA3
Other DBs
NCBI-GeneID: 109952263
NCBI-ProteinID: XP_020442902
LinkDB
Position
Unknown
AA seq 1123 aa
MPQNRAFSEPEYSAEYSADCSVTLPSDPERAVGQTHEVTVRTSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIIVMCAVVFNTDKLASVLVASAGLAADIL
LYLLCRFSLLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITAVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANVVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVDAISYVREKTRTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIETYLVVVSKGPVGKNGINSVKLSVTSSNGNSPLLINTTECNGSVNTACTTPEE
PEELDTKVVNPSFPXXXXXXLRLRDLAERVIDAQENEQELNKLLNEALLERETMQVLKGK
HTNRLSLRFVDPDLETRYSVEKEKQSGAAFCCSCMVLLFTAAVEALIDPWLIANYITFAV
GEVLLLILTICSLAAILPRVFPKKLVSFSTWIDHTRWARNTWAMAAIFILTLADIIDMLS
CLPGVPDFGSTALAPASSSSATWSDPDGCLNNPKYYSYIAVLALMATTMLVQVSHMVKLT
LMLLITVATGVVNIYSWRDIFDRYDVTRFQDYRSYLVPSKLTMTIMIFIMMVSFYFFSRH
VEKLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSY
DEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPPFRCITKIKTIGS
TYMAASGVTPDVSNSYTCMKKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFML
RIGLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRF
VRRGPIFVKGKGELLTYFLKGRDKQGSFISGASVTLPHQVVDS
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgcctcaaaaccgagccttttctgagccggagtactcggcggagtattcggcggactgc
tcagtgacattgccctctgaccctgaacgggctgtggggcaaacacacgaggttacagtt
cggacctcagggtgctgcctctgtctgcctcggttcatgcgcctcacctttgcacccgag
tctctggagaacctctaccagacctatttcagacgacagagacacgaaaccctgctggtg
cttgttgtgtttgctgccctctttgacagctacatcatcgtcatgtgtgcggtggtcttc
aacactgataagctggcttctgttttagtggcatctgctggactggcagcagatattctc
ctgtacctgctgtgccgtttcagcctgctgccagaccgcatttcaagacgagtggtgccc
tatgccctgtgggtgctcatagcagctcagatattctgttacctgggtctgaactatgct
cgcttccaccaggccagtgacactgtaggctggcaagccttcttcagcttctcctttttc
ctgaccttgcctttgaggctgacacccatcgtgctcatcactgctgtatcctgtggggtt
cacaccctggttcttggtgtcaccattgcccagcagcagcaggaggacatccagggagca
gcacttggcagacagttgctggccaacgttgtgatctatgtttgtgccatcactgtgggc
gttatgtcatactacatggctgaccggaagcatcggaaggcatttctggaggccagacag
tcactggaggtcaaactcaaccttgaggagcagagccagcagcaggaacgcctactgctc
tccattcttccaaagcacatagctgatgagatgcttcaagacatgaagaaggagcccagc
cagaaagagatgcagcaattcaacaccatgtacatgtacagacatgaaaacgtcagtatt
ttgtttgcagacatcgtgggcttcacccagctgtcatcgtcttgcagtgctcaggagctg
gtcaaattgctcaatgagctatttgctcgctttgacaaactggctgcaaaatatcaccag
ctgaggatcaaaatcctgggagactgctactattgtatctgtgggcttccagactacagg
gaagatcatgctgcctgctccatcatgatgggtctagccatggtggatgctatctcgtat
gtccgagagaaaaccaggacagatgttgacatgcgagttggagtgcacagcggtacagtc
ctaggaggagtgctgggtcagaaacgctggcagtacgatgtctggtccacagatgtcact
gtggccaacaaaatggaggctggagggataccaggtcgcgtccacatctcacagagcacc
atggagtgtcttcatggagagtttgatgtggagccagggaatggaggtgaccgctgtgac
tacctgagggagaggggcatcgagacctaccttgtggttgttagtaaaggacctgtggga
aagaatggcatcaacagtgtaaagctgtctgtaacctcttccaatggaaactccccattg
ttaatcaacaccacagagtgtaatggcagtgttaatacagcctgcaccacaccggaggaa
ccggaagagctggacacaaaggtggtaaatccatctttccctnnnnnnnnnnnnnnnnng
ctgcggctgcgggacctggctgagagggtgattgatgctcaagagaatgaacaggaactc
aacaaactgctcaacgaggctctgctggagagagagacaatgcaagttttgaaggggaaa
cacacgaacagactctccctgaggtttgtggatccagacctagagacccgttactctgtg
gagaaggaaaaacagagcggagctgccttctgctgctcctgcatggtcctactcttcact
gcagctgtggaggcactcatagacccctggcttattgcaaactacatcacctttgcagtg
ggagaagttctgcttctcatcctgacaatctgttctctggctgccatcctccctagagtc
tttcccaaaaagctggtgtctttctccacctggatcgaccacacccgctgggctcgtaac
acctgggccatggcagccatcttcatcctcaccttggccgacatcatagatatgttgagt
tgtctgcctggagtcccagactttggcagcaccgcattggctcctgcctcttcatcctcc
gccacctggtccgaccctgacggctgtctgaacaaccccaaatattacagctacattgct
gtgctggcactgatggctaccactatgctggttcaagtcagtcacatggtcaaactcaca
ctgatgctgctcattactgtggccacaggcgttgtgaacatctacagctggagagacatc
ttcgaccgctacgatgtgacccgcttccaggactacaggtcatatctggtgccctccaag
ctcacaatgacaattatgatcttcattatgatggtcagcttctattttttctccagacat
gtggagaagcttgcccgaaccctgttcctgtggaagattgaggtccatgagcagaaggaa
aaagtgtatgagatgaggcgctggaatgaagcactggtgaccaacatgctgcctgagcat
gtggctcgacacttcctgggctccaaaaagagggatgaggagttatacagccagtcttac
gatgagatcggagtcatgtttgcctcaatccccaacttctctgacttctacacagaggag
agcatcaataacggggggatcgaatgcttacggtttctcaacgagattatctcagacttc
gatagtctgctggatgagcctccatttcgctgcattacaaaaatcaagaccatcggcagc
acctacatggcagcatcaggtgtcaccccagacgtcagcaacagctacacttgcatgaag
aaggaggagcaatctgacagagagcgctggcagcacctggcagacctggcagactttgct
ctggccatgaaggttacgctcatgaacatcaactaccagtcattcaataacttcatgcta
cgaattggtctgaataagggcggggtgttagcaggagtgattggtgcccgcaaaccccat
tatgatatctggggcaacactgtgaacgtggccagtcgcatggagtcaacaggggtgatg
gggaatatacaggtggtggaggactgctacaacatcctaaaggagtacggcttccgcttt
gtgaggagggggcccatctttgtgaagggaaaaggggagttgcttacttattttctgaag
ggaagagacaagcaaggttcatttatcagtggtgcctctgtcactctgccacaccaagta
gtagacagctaa

DBGET integrated database retrieval system