KEGG   Monopterus albus (swamp eel): 109952284
Entry
109952284         CDS       T05607                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109952284
   04115 p53 signaling pathway
    109952284
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109952284
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109952284
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109952284
NCBI-ProteinID: XP_020442928
LinkDB
Position
Unknown
AA seq 104 aa
MGDVDKGKKVFVQKCAQCHTVEQGGKHKVGPNLWGIFGRQTGQAVGFSYTDANKTKGIVW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggagacgttgacaagggaaagaaggttttcgtccagaagtgtgcccagtgccacaca
gtagagcaggggggcaagcacaaagtaggccccaacctctggggtatatttggacgccag
actggccaggcagtgggcttctcttacacggatgccaacaagactaaaggtattgtgtgg
ggtgaggagaccttgatggagtacctggaaaaccccaagaagtacattcctggaaccaaa
atgatctttgctggaatcaaaaagaagggagaacgccaggacctcattgcataccttaaa
tctgcaacgtcatga

KEGG   Monopterus albus (swamp eel): 109954440
Entry
109954440         CDS       T05607                                 

Definition
(RefSeq) cytochrome c iso-1/iso-2-like
  KO
K08738  cytochrome c
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109954440
   04115 p53 signaling pathway
    109954440
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109954440
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109954440
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109954440
NCBI-ProteinID: XP_020445423
LinkDB
Position
Unknown
AA seq 62 aa
MGDVDKGKKVFVQKCAQCHTVEQGGKHKVGPNLWGIFGRQTGQAVGFSYTDANKTKGEFT
GG
NT seq 189 nt   +upstreamnt  +downstreamnt
atgggagacgttgacaagggaaagaaggttttcgtccagaagtgtgcccagtgccacaca
gtagagcaggggggcaagcacaaagtaggccccaacctctggggtatatttggacgccag
actggccaggcagtgggcttctcttacacggatgccaacaagactaaaggtgagttcact
ggtggttaa

KEGG   Monopterus albus (swamp eel): 109958102
Entry
109958102         CDS       T05607                                 

Definition
(RefSeq) cytochrome c-b
  KO
K08738  cytochrome c
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109958102
   04115 p53 signaling pathway
    109958102
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109958102
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109958102
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 109958102
NCBI-ProteinID: XP_020452133
LinkDB
Position
Unknown
AA seq 105 aa
MSGDINKGKKTFVQKCAQCHTVEEGGKHKVGPNLWGLFGRKTGQAQGYSYTDANKSKGVI
WDEETLMTYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKSATS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtctggagacatcaacaaaggtaagaagacatttgtgcagaagtgtgcccagtgccat
actgtggaggagggtggaaaacataaggttgggcctaacctttggggtctgttcggacgc
aaaacaggccaggcacagggctactcatatactgatgccaacaaaagcaagggtgttatc
tgggatgaggagaccctgatgacctatttggagaaccccaagaaatatattccaggaaca
aaaatgatcttcgctggcatcaaaaagaagaatgaacgggctgaccttatagcatatctt
aagtctgcaacttcataa

DBGET integrated database retrieval system