KEGG   Monopterus albus (swamp eel): 109952391
Entry
109952391         CDS       T05607                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
malb  Monopterus albus (swamp eel)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 DUF1926 C1_2
Other DBs
NCBI-GeneID: 109952391
NCBI-ProteinID: XP_020443096
LinkDB
Position
Unknown
AA seq 356 aa
MYKCELIELKDLTVNDPIELTAPTAHTALAPVNPGQPSPFYVVRLVGDSTKAPGCQTGEA
GAGHDFQPYTHTHLTWCDLCGEFIWGLYKQSLRCTNCSYTCHYRCRPFIQLDCSTDGRLL
TDQADFSVDSIETDTNVDEQIDLGKKDLSAGEIHQKVMEYNAQVNSNFYMVVNKDGSYTG
FIKVHFQLVRPISLPPPQKLRSTQEDDQQSKQIRRRTSFYLPKDTAKHLHVSSQTRAQEV
IEALLNKFTVVDNPAKFALFERTERQSQVYMRKLSDDECPLYLRLCAGPSEKVLSLVLKD
SETGDVNWDAFSIPELHNFLRILQREEEEYIRQIEKRYACAREKMKQAMARITTPG
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtataagtgtgagttgattgagctgaaggacctcactgtgaacgatcccatcgagctc
accgctcctacggcccacacggccctggcacctgtaaacccaggtcagcccagccccttc
tatgttgtccgtctggttggagacagcaccaaagcgcccggctgtcagacaggagaggct
ggagcaggtcatgacttccagccctacactcacactcatctcacttggtgtgacctgtgt
ggggaattcatctggggtctttataagcagagtttgcgctgcaccaactgcagttacact
tgtcactaccgctgtcgaccattcatccagctggactgcagcacagatggaaggctatta
acagaccaggcagatttctctgttgactctattgaaacagacacaaatgtggatgaacag
atcgatttgggtaaaaaagacttaagtgctggtgagattcaccagaaggttatggagtat
aatgctcaggtcaacagcaatttctacatggtggttaacaaagacgggtcctacactggt
ttcatcaaagtccattttcagttagtgcgtccgatctccctccctcctcctcagaagctg
cgctccacacaggaggatgatcagcagtctaaacagattagacggcggacatctttctac
ctccccaaagatactgcaaagcacctgcatgtaagctcccaaacacgggcacaagaagtc
atcgaggcattgctcaacaagttcaccgtggtggacaacccagccaagtttgccctgttt
gaacgcactgagagacaaagtcaagtgtacatgcgaaaactgtctgatgatgaatgtcca
ctctacctacgcttgtgtgctggccccagtgaaaaagttctgagtctggttttgaaagac
agtgagacaggggatgtcaattgggatgcatttagcattcctgagctgcacaacttcctg
cgtattctgcagcgtgaggaagaagagtacatccgtcagattgagaagcgctacgcttgt
gctagagagaagatgaagcaggccatggcaaggattactacccctggctga

DBGET integrated database retrieval system