KEGG   Monopterus albus (swamp eel): 109952481
Entry
109952481         CDS       T05607                                 

Gene name
atf6b
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04141  Protein processing in endoplasmic reticulum
malb04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109952481 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109952481 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109952481 (atf6b)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109952481 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf HAUS6_N MCU DUF4140
Other DBs
NCBI-GeneID: 109952481
NCBI-ProteinID: XP_020443231
LinkDB
Position
Unknown
AA seq 713 aa
MSTDLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDGDFGRELKYDTLFDNDLVLTL
DPDNPTSPWQHLRDNLLTGDAPVIKSEMTITQPLPVEMLFQVKAEPPSPASSLGSDCSAS
SPEPQITVKGENPPTPPYMYGDVLSPPLGSMEVTVATTTVPPLQTQIQTPLTTHIPAVIS
GIQTQATVLPSSSSLKASTILSTKPPIQPRPVCVTTLPVPQTPAPAKALILQGLPSMDQS
RPVVLSQSVCLGSAPAIVKVEPVSPSISQHCSNPTAPSTSKPIVPATSALPGNNSNDVDM
KVLKRQQRMIKNRESACQSRKKKKEYLQNLETQLREAQQENERLRRENQALRERLAGKEG
SDSASNKRAVCVMAILLFLTFSFGPVSITDKTLSTGLQDSVVSFTGRQLLEVQPHRQVAA
EPPSRAEDRTEMEDDPGDDRWKKGEAERYAPEAFQFRNLSDVFSDVKDLVLQDIDRYFTS
SDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKAKMAKKAKMAQKAQLRKSNFSRYLP
IQAHRTIDSQLQLLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKM
SLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKFSAVPPSLRDPPPPSPSSPPH
HHHHGNHTSLRGRHQHHSSSSSSSSASSSSSPRHRLPAPQQTSEYLISQSEGV
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgagcacggatctgttatccgatttggacagccggttcttcgctgataacctcctgaca
agcgaagactgggatgcctgcctgtaccagtgtgagagcatggaggagggagaggacgga
gacttcggcagagaattgaaatacgacacgctgtttgacaatgacctcgtcctcaccctt
gatcctgacaaccccacatcgccatggcaacacctcagagacaacctgctcacaggggac
gctccggtaataaaaagtgaaatgaccatcacacagccgttaccggtggaaatgctgttc
caggtgaaagcagagcctccctctcctgcatcgtcgctcgggtctgactgctcggcgtca
tcaccagaacctcagatcacagtcaaaggtgaaaaccctcccactcctccgtacatgtat
ggagacgtgctgtcgcccccgctgggatctatggaggtcaccgtggcaacaacaaccgta
ccccccctgcagacacagattcagacgccgttaaccacacacatcccggcagtcatcagt
ggaatacagacgcaggccacagttctgccgagctcatcctcattgaaggccagcaccatc
ctgagcaccaaaccccccatccagcccagacccgtgtgtgtcaccaccctgcctgtcccc
cagaccccagcaccggccaaggcgctcattctgcagggcctcccctccatggaccagagc
agacctgttgtcctgtctcagtccgtctgtctcggttcagctccagccatcgtcaaagtg
gagcccgtctctcctagcatctcccagcactgctccaaccccacagccccatccaccagt
aaacccatcgtcccggcaacctcggcgttacctggcaacaactccaacgacgttgatatg
aaggtgctgaagcggcagcagaggatgattaagaaccgagagtcggcctgccagtcgagg
aagaagaagaaggagtacctgcagaatctggagacgcagctgagggaggcccagcaggag
aacgaacgacttcgcagggagaaccaggcgctgagggagagactagctgggaaagagggc
agcgactctgcgagtaacaagagagccgtttgtgtcatggccattctgctgtttctgacc
ttcagctttggacccgtcagcatcacagacaagacactgtcgacaggcctgcaggacagc
gtggtgtcatttacaggacgccagctgctagaggtccaaccacatcggcaggtggctgct
gagcctccaagcagagcggaggacaggacagagatggaggacgacccaggggatgatcga
tggaagaagggggaggcggagagatatgctccagaggcatttcaattcaggaacctgagt
gacgtgttcagtgacgtgaaggacctggttcttcaggacattgaccgttacttcacctcg
tcagactgcagacagttcaaccgctccgagtcgctcaggctggcggacgagctgaggggc
tgggttcaccgccatcagatcgaccgtaagaagtctggagggaaagcaaagatggccaag
aaggccaagatggcccagaaagctcagctgaggaagagcaacttctccagatatctgccg
atccaggctcaccgcaccatagacagtcaactgcagttgcttcctggtcctgaggtcacc
tacagcgacttcctggatgccatcgaccgcagagaggacacgttctacgtcgtttctttc
agacgggaccacctgctgttaccggccatcagccacaataaaaccagccggcccaagatg
tctctggtgatgccggcaatgtctgtgaacgagagtctgtataactcctctcagggctac
gagatgatgatgcaggtcgactgcgaggtcatggatactcgaatcgtccccatcaagttc
tccgccgtcccaccgtctctccgcgaccctcctccaccttccccttcctcacctccccac
caccatcaccacggcaaccacacctcactccgaggacgccaccagcatcactcctcctca
tcttcgtcttcctcagcatcctcgtcatcgtctccaaggcatcgtttacctgccccccaa
cagacgtccgaatatctaatcagccagtcagaaggagtttga

DBGET integrated database retrieval system