KEGG   Monopterus albus (swamp eel): 109952614
Entry
109952614         CDS       T05607                                 

Gene name
rbl1
Definition
(RefSeq) retinoblastoma-like protein 1
  KO
K04681  retinoblastoma-like protein 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109952614 (rbl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109952614 (rbl1)
   04218 Cellular senescence
    109952614 (rbl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109952614 (rbl1)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    109952614 (rbl1)
SSDB
Motif
Pfam: RB_A DUF3452 RB_B
Other DBs
NCBI-GeneID: 109952614
NCBI-ProteinID: XP_020443437
LinkDB
Position
Unknown
AA seq 875 aa
MRGEESSDSESGRMEESSVRRSLETLCQELNMDGQTATEAMENFTAIWNTYTLEGELVHC
LACALYAACRKGSTPTVGKGLMEGNCVSLTRILRSSKLSLIQFFSKMKKWADMSNLSHDF
RLRIERLERNFEVSTVIFRKFEPIFMDMFQNPQGGEPPRQPRSRKHRRLPCHISDLFKFC
WTLFVYAKGNFRMIGDDLVNSYHLLLCCLDLVFGNALLCANRKDLINPAFKGLPASYWAD
GHTSADEPPPCVLERLCELHDGLVVEAKGIKQYYFRPYIQKLFQRQILRGNEEHLTEMLD
PHNFIDNSKAINREYEEYVLTVGDFDERVFLGVDADEEIGTPRKIVQETSTSQKQLQHVE
KSGSLAPSTPLTGRGYLKEKDLLVTPVSSATQSVSRLQSMVASLRTAPSDQLMQIFKLCS
RDPTESILARVKTLGQTFKEHYTKDSEDAPGSHIDFAENRLKLAEILYYKILENVMVQEM
KRLQGKDMSVLLEQDIFHCSLMACCLEVVLFSYSSQRTFPWIINVFKLAPFYFYKVIEVF
IRSEEGLSRDMVKHLNSIEEQVLESRAWTSDSALWSALQAAENRVPTVEEVNFSSNLDSG
SGLTSGGPSYLPLLTLSPIIHPRIREFRSGLDSARKDVPPSPLSVHDRYSSPAAGSLVKR
RLFGDDPPAPKTGLNPGMSPASSPAKRLTFGSSSTLRIGEQETQTTIPVLSIPLQVAARS
NDCTITLIPVQPCDSTAQFLVTASPSRAATAHTTSEAQTGNGRPRRTGSLALFFRKVYHL
ASVRLRDLCARLDISSELRGKIWTCFEHAVVHCTDLMKDRHLDQLLLCSISIISKITKET
LTFQDIMKYYRSQPQASSHSKCRHNRKTGRGNRII
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgcggggcgaagagtcgtcggattcggagtcggggaggatggaggaaagttcagtccgg
aggagtttggagaccttgtgtcaggagttgaacatggacgggcagacggcaactgaagcc
atggagaacttcactgccatatggaatacttacacactggagggggagctggtgcactgc
ctggcctgcgctctgtatgcagcctgcaggaagggctccacacccacagtgggcaaaggg
ctgatggagggaaactgtgtctctctcaccaggatccttcgctcctccaaactcagcctg
atccagttcttctcaaagatgaagaagtgggccgacatgtccaacctgtcgcatgacttc
aggctgcgcattgagcggttggagcgcaacttcgaagtttccacagtgatcttccgcaag
tttgagcccatcttcatggacatgttccagaacccacaggggggcgagccaccacggcag
ccgcgcagcaggaaacacaggcggcttccctgtcacatcagcgatttgttcaagttctgc
tggactctgttcgtctatgccaaaggtaacttccgtatgatcggtgatgacctggtcaac
tcgtaccacctgctgctctgctgtctggacctggtgttcggcaacgctttgctctgcgcc
aacaggaaggacctcatcaacccagcgttcaaaggtctgcctgcttcgtactgggctgac
ggtcacacttcagcggatgagcctcctccgtgcgtgttagagaggctgtgtgagctgcat
gacgggctggtggtggaggccaaaggcatcaaacagtactacttcagaccctacatacag
aaactgttccagagacagatcctgagaggcaacgaggagcatttaacagaaatgctggat
ccacacaacttcattgataacagtaaagccataaacagggagtatgaggagtacgtgttg
acggtgggagatttcgatgagcgcgtgtttcttggagtcgatgctgatgaggaaattgga
actccaaggaagattgtgcaggaaacgtctaccagccagaaacagctacaacatgtagag
aagtccggttctttggctccctccacccctctgaccgggcggggctacttgaaggagaag
gacctgctcgttacacctgtgtcctcagcgacgcagagcgttagccggctgcaaagcatg
gtggccagtttgaggacagcacccagcgaccagctgatgcagatcttcaagttgtgctcc
agagaccccacagagtccatactggccagagtaaagaccctgggacaaaccttcaaagaa
cattacaccaaagactctgaggacgcgcccggctctcacatagactttgcagagaaccgt
ctgaagctggctgagatcctttactacaagatcctggagaacgtcatggttcaggagatg
aaacggctgcagggcaaagacatgagcgtgttgttggagcaggatatcttccattgttcc
ctgatggcgtgttgtctagaggtggtattgttctcctacagctcccagaggacgttcccc
tggatcatcaatgtcttcaaattggccccattctatttctataaggtgatcgaggtgttt
atccgctcagaggaaggtctgtccagagacatggtgaagcacctgaactcaatcgaggag
caggttctggagagcagagcgtggacctcagactctgccctgtggagtgccctgcaggct
gctgagaacagagtccccacagtagaggaggtgaatttctcctccaatcttgacagcggt
tctggtctcaccagtggagggccgtcctatctgcctctgctcaccctctcccccattatc
caccctcgtatcagggagttcagatcaggtctggatagtgcacgcaaagatgtgcctccc
tccccattgtcagtccacgacaggtatagctccccagcagctggctctttggttaaacgc
cggctctttggcgacgatcctccggccccaaagacgggactgaaccccggtatgagcccg
gcctcgtctccagccaaaaggctgacgtttggttcgagcagcaccctgaggattggagaa
caggagacccagaccaccatccccgtcctgagcatcccactgcaagttgcagctcggagt
aatgactgcacaattacactgatcccggttcagccatgtgactccactgctcagttcctg
gtgaccgcctccccaagccgagcagccaccgcacacaccacctctgaggcccagacagga
aatggccggcctcgacgcaccggatccctcgcgctgttctttaggaaggtgtatcacttg
gccagcgtacgtctgagggacctgtgcgccaggctggacatctcctcagagctgcgaggg
aaaatctggacgtgttttgaacatgctgtggtccactgcacagatctgatgaaggacaga
cacctggaccagctgctgctgtgcagcatttccatcatatccaaaatcactaaagagact
ctcaccttccaggacatcatgaagtattatcgcagccaaccacaggccagcagccattca
aagtgccgacacaaccggaagacaggtagaggaaaccgcattatttaa

KEGG   Monopterus albus (swamp eel): 109955832
Entry
109955832         CDS       T05607                                 

Gene name
rbl2
Definition
(RefSeq) retinoblastoma-like protein 2
  KO
K04681  retinoblastoma-like protein 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109955832 (rbl2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109955832 (rbl2)
   04218 Cellular senescence
    109955832 (rbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109955832 (rbl2)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    109955832 (rbl2)
SSDB
Motif
Pfam: RB_A RB_B DUF5584
Other DBs
NCBI-GeneID: 109955832
NCBI-ProteinID: XP_020448017
LinkDB
Position
Unknown
AA seq 530 aa
MATDPESSPGKPRFGPSDRLIAMFRACIRDPTEAIKARLRHMLHTFLQHIRDNAENEKTK
ELAVKCCCKAEVWYYRILEDLVSREGKSQGVSGISGILENDLLQCCLVVCCLEITIYSSC
LRCDLPLLLHLFKLPAYDFWKVTELVLWIEVTLHHSDARHLTQVKEKVLESLAWTSNSSL
WEEIRANEGHLPTCQQVMPPTQLEDPQRTELHPDGSLPGVGGSLGADSTDHQCSPSAGNR
PRSSSFLHVFARKVYSLMGKRLRELCSIMGISDELRLKIWTCFEYSLVYCNYLMVGHHLD
QLLMCAIYIIAKITEREIPFKHIMKCYKSLPHAKKSVSITKINKDNGDRSDLTPSTPSKH
YPGSCREERSNLIYFYNEVYMKKMRDFAGQLASTSGADTPPLSPYPQEQRASPRRRQVSS
SHPIFISLLDPETTSPCKTSLSYYFSSSPPERLREINNMVRTGWSPNRPCPAMSPDRGEE
AGDDGPSAKRLRMADQSAWQRRLRNVVSDRVTRRNQDQYQSSPVTKPNLP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcaaccgaccccgagagcagcccgggaaagccgagatttggccccagtgaccgcctg
attgccatgttcagagcctgcatcagagatccaactgaggcaataaaagcacgactgaga
catatgttgcacacatttctgcaacacatcagggacaatgcagagaatgagaagaccaaa
gagttggcagtaaagtgctgctgtaaggctgaagtctggtattaccgaatcctggaagat
cttgtcagtcgagaggggaaaagccagggtgtcagtggcatttcaggcattttagagaat
gatcttctccagtgctgtctggtggtctgctgtctggagattaccatatactcaagctgt
ctgcgatgtgacttacctctgctccttcacttgttcaagctgccagcatatgacttctgg
aaggtgactgagctggtgctgtggattgaagtgacactgcatcactctgatgccagacac
ctcactcaagtgaaagagaaagtcctggagagcttggcctggaccagcaactcatcgctg
tgggaagaaatcagagccaatgagggtcatctgcctacctgccagcaggtaatgcctcct
acacagctagaagatccacagagaacagaactgcaccctgatggaagccttccaggagtg
ggtggcagtttgggagctgacagcactgaccatcagtgttccccatcagctggaaacagg
cctcggagcagcagcttcctccatgtgtttgctcgtaaggtttacagcctgatgggaaag
cgtctgagggagctatgttccataatgggaatttctgatgagttacggttgaagatctgg
acctgttttgagtactctctggtctactgcaactatctcatggtaggccatcacctggac
caactgctgatgtgtgccatctacatcatagctaagattaccgagagggaaatacccttc
aagcacataatgaagtgctacaagtctctgccacatgctaagaaaagtgtaagcataaca
aaaataaataaagataatggagaccgcagtgacctgacccccagcacaccatcaaaacat
tatccaggatcctgtcgggaggagaggagcaatcttatctacttttacaacgaggtctac
atgaaaaagatgcgggactttgctggtcagcttgcctcgacctcaggtgctgatactcca
cctttatctccatacccccaagagcagagagcatctcctcgcagacgtcaggtgtccagc
agccaccccatcttcatttcactgttggaccctgaaaccacctccccttgtaaaacctcg
ctctcctactacttcagttcaagtcccccagagcgtctgcgtgagatcaataacatggtc
agaacaggctggtctcccaacaggccatgccctgcaatgtcaccagacagaggggaggag
gcgggagatgatggtccttcagcaaaaaggcttcgtatggcagaccagtcagcctggcag
aggcgactgaggaatgtggtgagcgatcgtgtcacaagaaggaaccaggatcagtaccag
tcgtctccagttacaaagcctaacctgccctag

DBGET integrated database retrieval system