KEGG   Monopterus albus (swamp eel): 109952643
Entry
109952643         CDS       T05607                                 

Gene name
ep300
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04330  Notch signaling pathway
malb04350  TGF-beta signaling pathway
malb04520  Adherens junction
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109952643 (ep300)
   04330 Notch signaling pathway
    109952643 (ep300)
   04350 TGF-beta signaling pathway
    109952643 (ep300)
   04068 FoxO signaling pathway
    109952643 (ep300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109952643 (ep300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109952643 (ep300)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109952643 (ep300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109952643 (ep300)
   03036 Chromosome and associated proteins [BR:malb03036]
    109952643 (ep300)
   03029 Mitochondrial biogenesis [BR:malb03029]
    109952643 (ep300)
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109952643 (ep300)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109952643 (ep300)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109952643 (ep300)
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109952643 (ep300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 109952643
NCBI-ProteinID: XP_020443476
LinkDB
Position
Unknown
AA seq 2739 aa
MADNVLESGPPSAKRPKLSSPALSVSASDGNDFGSLFDLEHDLPDELISSSDLGLTNGGD
PSQLHTSLGAVGGGADVGGGQDAAAKHKQLSELLRAGASTQQGGPASNSTAPGAAMGMMG
GVGVSPSGPQGLPPQGQQQQPGLMQQVGIVGGVAALNRAAAMMGAQKGNTGQQQQGLMGG
QVMNGSPRMGYPGSAGMGNNGNLLAETLQQQGQQMGPGGPAGMRPQPPGSLNKMNMMANA
GPYGGPYGQSAGQGLPGAGLGPQLQNKPGLPNNMTPQFNMDKKAPPSQGMPGMAPQQQQQ
QQLPPPRGVVSVAGAAAGGGPRVGLSAVGAGPGTAPPTADPEKRKLIQQQLVLLLHAHKC
QRREQANGEVRHCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDC
PVCLPLKSAGDKRNQQSLVNTAGVGLVNSLGSGVSGGQSNAPNLNPPNQIDPSSIERAYA
ALGLTYQGNQMPQQPPQANMPNQGLQGQPGMRPLNTMGGNSMGVNGGVGVQPPSQQSTLL
PDAMLHNSMNAQSLMNDGVGNVGSMPTAGPPSVAGMRKSWHEDIKQDLRNHLVHKLVQAI
FPTPDPAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTR
LQKQGMMPSQPGISPSGLPQGPPSLGQPPIAPGQPPNGPHADPSMVRPAGPNQMVSRMQS
PAGMSQFGQMGMQSMGQRSTPPLPLNAPVNQMGMGATRMGQPSATQLQNQYLPQGQFPVS
SPGLGSGPVGMNQPGAQTAVPPQNQMPTPPSLPASSPAAPSAAGAPGGSVGSGSTSGATP
VPNLPPSSTPTQPNSYPHCPPIRTNSPSPARSLTPQPHQTPPRVPGSQTPQPQTPSTSQL
PPLQHPQQQQQQVLQHSSEVVNSEKASQLPQQTLGSVASSGPHNSLVPPQNAHVSLQLPP
TPLSQKASLTADGQVSSPASVNSSADPSSQLAPADGPPPSQEDVKVEMKKQEEDDEGADI
QGDGKGKIGKGQPDVKMEEKPEIKKEKPSGEGCKDEPMDTSSSSASSSAAAGEDKKRELK
KEPKEEEEGSGSTATNSSSVSTQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYIEDIWLMFNNAWLYNRKTSRVYK
YCSKLAEVFEAEIDPVMQGLGYCCGRKFEFSPQTLCCYGKQLCTIQRDAAYFSYQNRYHF
CEKCFNEIQSESVSLGDDPSQPQTSISKDQFQRKKNDTLDPELLVECIDCGRKMHQICVL
HNETIWPSGFVCDNCLKKANKTRKENKYAAKRLPQTKLGSYLETRVNDYLKRQNHSESGE
VTIRVVHVSDKMVEVKPGMKSRFVDSGEMAESFPYRMKALFAFEDIDGADVCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPRHLRTAVYHEILMGYLEYVKRLGFTTGHIWACPP
SEGDDYIFHCHPVDQKIPKPKRLQEWYKKMLDKAVAERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENSTSSESTDATKGDSKNAKKKNNKKTSKN
KSSLSRANKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPTANSLPSITDPDPLM
ACDLMDGRDAFLTLARDKHLEFSSLRRSKWSSMCMLVELHNQSQDRFVYTCNECKHHVET
RFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDDSNNQSAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRVGQPAGGPSGGPMAGLPSPGNS
GTTAPSTPTSGGTQPPTPQTPTQSMPPVPQQGMGPGPGVQQQPQPGGMPSQSGGMPPQHP
LHHQFQQVVGGGGGAGGIMGSPQHQQQMLSQVQQQQSGAGASGQQLQQHPNNLPPYASRP
PGSSPIHQSQGKPVLGSATPPHQQPGGSVMVGSVGGQQTPNQPQGQLPLPQQQQQPSAGP
PQAAVEIAMKIQQVADAQRKMALQRQAAKATAGMMSPHHQQGQGQQMGVGHPGSVGVGGP
QGIPPQSQAAVAAARAHMDQQQGAVPGMMGGPMQQPPQQGNLPQGQLPPQVQLQQPRMGA
PLQNPQQPQQQWTGPGMPPQQRQALMNQMGHSAMMAAQQQQQQQQAQGHAALMNMAQQQQ
GPGGGVAAGFGAAAVLGAAGGNIPQAALQDLLRTLRSPSSPLQQQQVLNILRSNPQLMAA
FIKQRASKYKGVQGPPGGPGGVPGGPGPTGAPVGNVMAGGGAQGEMNKKVAALQQQQQQQ
QQQQQQQQQQGGARGIQGQGPQMGNLNNPQFREMLMIRHLQHQQQMGVNHGQFQQPQPPQ
GQGYMGQPGMQPPTVGQGPPGGPSLGSQQPGGAPGQQGQGYPGSVAQQQATAALQQRLQH
QHHLQMQQQNAMAGLSGCDAGPSGGAVGGPPQPPQGPQPTQSGPPPPSTQALLQQALHQR
LLQQQQQHLGAGGSPAQHSNPMSPQQPQQMSQSPHPHLQGQALPTSLANQVRSPQPSPRP
QSQPPHSSPSPRMQPQPSPHHISPQMQTSSPHPGHLNQHHPGMVVPPQQQQQQNSVEHYG
SDQSTMLSQMSGMAGLHRPGGNSQDPLGQNINHNPLDII
NT seq 8220 nt   +upstreamnt  +downstreamnt
atggccgataatgtcctggagtccggcccgccttcagccaagaggcccaagctatcctct
ccagctctctcggtgtctgccagtgatggaaatgactttggttccctctttgacttggaa
catgacctcccagatgagctcatcagttcctcggacctgggactgaccaatggaggggat
cctagccaactgcacaccagtcttggagcggttggaggaggggctgatgttggaggaggc
caggatgcagctgcaaaacacaaacagctgtctgaactcttgcgtgctggagcatctaca
cagcagggtggccctgcatctaacagcacagcacctggggctgccatggggatgatgggg
ggtgtcggtgtctcccccagtggacctcaaggcctgcccccccagggccagcagcagcaa
cctggattaatgcagcaggttggaatagttggaggggtggccgcactcaatcgggcagct
gccatgatgggtgcccagaagggcaacactggacagcagcagcaagggctaatggggggg
caggtgatgaatggctcaccaagaatgggttaccctggcagtgcaggcatgggtaacaat
ggtaacctgttggcggaaaccctacagcagcaaggtcagcaaatgggacctgggggtcca
gcagggatgaggccacagccgcctggatcactgaacaagatgaatatgatggccaatgcg
ggcccctatggtggtccgtacggccagtctgcaggccaggggcttcctggagcagggctg
ggcccacagctccagaataagccaggcctccccaacaacatgaccccccagttcaacatg
gacaagaaggcaccaccgagtcagggcatgcctgggatggccccccagcagcagcagcag
cagcagcttccgccgccccggggggtggtgtctgtcgcaggagcagcagcagggggaggg
ccccgggttgggctgagtgctgtaggggcaggtcccggcacagcgccccctactgccgat
cctgagaagcggaagctgattcaacagcagctggtcctcctgcttcatgcacacaagtgc
cagcggagggagcaggccaacggtgaagtgcgacactgcaacctgccccactgtcgcacc
atgaagaacgtgctcaaccacatgactcattgccaggctggcaagtcctgccaggttgca
cactgtgcctcgtccagacagatcatttctcattggaagaactgcacacgacacgactgt
cctgtttgcctgccactgaaaagtgctggagacaagaggaaccagcagtctcttgtcaac
actgcaggggtgggtttggtgaactctttaggttcaggcgtgtcgggtgggcagtccaac
gctccgaacctgaaccctccaaaccagattgaccccagctccatagagagggcctatgct
gcactgggcctcacttaccagggcaaccagatgccacagcagccaccacaagccaacatg
ccaaaccagggactgcaggggcagcctgggatgagacctctaaacaccatgggagggaac
tctatgggagtaaatggtggagtgggggtgcagccccccagccagcagtccaccctactg
ccagacgccatgttgcacaacagcatgaatgcacagagtttgatgaatgatggtgtggga
aatgtgggttccatgcccacagcaggtcctccttctgttgctggtatgaggaagtcttgg
catgaagacatcaagcaggacctccgcaaccaccttgtccacaagcttgtgcaggccatc
ttccctactcctgacccagctgcactgaaggatcggcggatggagaatctggtggcttac
gctcgaaaagtagagggagacatgtacgagtcagccaacagcagggcagagtactaccac
ctgctggcagagaagatctacaaaatccaaaaggagctggaagaaaagaggaggacacgc
ctgcagaagcagggcatgatgcccagtcagccaggcatatccccctcaggcctcccgcag
ggcccccccagcttgggacaaccgcccatagccccagggcagcccccaaacggtcctcac
gccgatccatccatggtccgaccagctgggcccaatcagatggtcagcaggatgcagagc
ccagcgggaatgagccagtttggtcagatggggatgcagtcgatgggtcagaggtcgaca
ccccctcttccacttaatgctccagtgaaccagatgggtatgggagcaacaaggatgggt
cagcccagtgccacacagttacagaaccagtatctccctcaaggccagtttcctgtgtcc
agtcctggacttggttctggtcccgttggtatgaaccagccaggagcacagactgctgtg
ccaccgcagaaccagatgccaactccaccttctctcccagccagcagccccgcagcaccg
tccgccgctggagcccctggaggctccgtggggtctggtagtaccagtggtgccacacct
gtaccaaacttgcctccatcctccaccccgacccaacctaactcctaccctcactgccca
cccatccgaacaaactcgccatccccagcgcgcagcttaacgcctcaaccccatcagaca
ccccccagagtgcctggttctcagactccccagccacagacccccagcacatcacagctg
ccccctctacagcacccccagcaacagcaacaacaagttttgcaacactcatctgaggtg
gtgaactctgagaaggccagtcagcttccacagcagacacttgggagtgtggcttcttca
ggcccccacaattctttggtgcctccccagaatgctcatgtgtcattgcagctgcccccg
actccgttatctcagaaggcttctctgacagcggacggtcaggtgtcctctccagcctca
gtcaacagcagtgctgatcccagctcccagctcgcaccggcagacggccctcctcccagc
caggaagatgtcaaagtggagatgaagaagcaggaggaggatgacgaaggggctgacatt
caaggagatggcaagggcaaaattggcaagggtcagcctgacgtgaagatggaggaaaag
ccagagatcaagaaagagaagccatcaggagaggggtgtaaagatgagcccatggacaca
tcttcatcctctgcgtcttcctcagcagcagcaggtgaagacaagaagcgagagttgaag
aaagagcccaaagaggaggaggaggggtcggggtcaacagccaccaacagctcctcagtc
agcactcaaagcaagaagaaaatctttaagccagaggagctgcgccaggcactgatgccc
accctggaagctttgtaccggcaggaccctgagtcccttcccttccgtcagccggttgat
ccccagttactgggaatacccgactactttgatatcgtgaagaaccccatggacctgtca
accatcaagcggaagctggacactgggcagtaccaagagccgtggcaatacatcgaggac
atctggctgatgttcaacaacgcctggctgtacaaccgcaagacatcccgcgtctacaag
tactgctccaaactggctgaggtgtttgaggcagagatcgaccccgtcatgcagggactg
ggatactgttgtgggagaaagtttgagttttccccccaaactctatgctgctatggaaaa
cagttatgcaccatccaacgtgacgctgcttacttcagctaccagaacaggtaccacttc
tgtgagaagtgtttcaacgaaatccagagcgagagtgtttccctgggggacgacccctcc
caacctcaaacgtccatcagcaaagaccagttccaacgaaagaagaatgacacactcgat
cctgagttgcttgtggagtgtattgactgcggtcgtaaaatgcaccagatctgtgtcctg
cataatgaaaccatatggccgtcaggctttgtatgtgacaactgcctcaaaaaggccaat
aagacacggaaagagaacaaatacgcagccaaaaggcttcctcagaccaagttagggagc
tatttggagacacgagtgaatgactacctcaagcgacagaaccactccgaatctggtgag
gtcaccatccgagtggtccatgtctcagacaagatggtcgaggtcaagccgggcatgaag
tccaggtttgtggacagcggagagatggccgagtccttcccgtacaggatgaaagccttg
tttgcatttgaggacatcgatggagcagatgtgtgtttttttggcatgcacgttcaagag
tacggctcggactgcccacctcccaatcagaggcgagtgtacatctcttacctggacagc
gtacacttcttcagacctcgacacctccggactgctgtctaccatgagatcctgatgggc
tacctggagtatgtgaagaggctggggtttacaacagggcatatctgggcctgtccaccc
agtgaaggggatgattacatcttccactgtcacccggtggaccagaagatccccaagcca
aaacgcctgcaggagtggtacaagaagatgctggacaaggctgttgctgagcgcattgtc
catgattacaaggacatcttcaagcaggcgactgaggaccggctaaccagtgccaaggag
ctgccatacttcgagggtgacttctggcccaatgtgctggaggagagtatcaaggagctg
gagcaggaggaggaggagaggaagagggaggagaacagcacctccagtgagagcacagat
gccacaaaaggagacagcaaaaatgccaaaaagaagaacaataaaaagacgagcaagaac
aagagcagcttgagtcgagccaacaagaagaaaccagggatgcccagtgtttccaatgac
ctttctcagaaactctatgccactatggagaaacataaggaggtcttctttgtcatccgc
ctcattgctggtcccaccgccaactccctgccctccatcactgacccggaccccctgatg
gcttgtgacctgatggacggccgtgatgccttcctgactcttgccagggacaagcacctg
gagttcagctccctcaggaggtccaagtggagctccatgtgtatgttggtggagctgcat
aaccagagccaggaccgcttcgtctacacctgcaacgagtgtaaacaccatgtggagacc
cgcttccactgcactgtctgtgaggactatgacttgtgcatcacctgctacaacactaaa
ggtcatgagcacaagatggataagttgggacttgggttggatgacgacagcaacaaccag
tcagcagccgctacccagagccccggagactcccgtcgcctaagtatccagcgctgcatt
cagtcgctggtccacgcctgccaatgccgcaacgccaactgctccctgccatcctgccag
aagatgaagcgtgttgttcagcacacaaaaggctgcaagcgcaagacgaacggcggctgc
cccatctgcaagcagcttattgctctgtgctgctaccatgccaaacactgtcaggagaac
aaatgtccagtcccgttctgtctgaacatcaagcaaaagctccggcagcagcagctgcag
caccggctccagcaggctcagatgttaaggagaagaatggccagcatgcagagggtgggg
cagccggctggagggccatcaggggggcccatggccgggcttccatcaccaggaaacagt
ggtaccacagcacccagtaccccaacatctggcggaacccaacccccaactccccaaacc
ccaactcagtccatgcctccagtgccgcagcagggaatgggtccaggacctggagtacag
cagcaaccacagccaggtgggatgccttcacagagtggtgggatgcctccgcagcacccc
cttcaccaccagttccagcaggtagtaggtggaggtggtggggctgggggaataatgggt
tctccccaacatcagcagcagatgctttctcaggtccagcagcagcaaagtggagcaggg
gccagtggtcagcaactacagcagcatccaaacaacttgcccccatatgccagcagaccc
cccggctcctcccccatccaccagtcccagggtaaaccagtccttggctctgcaacacct
ccccatcagcagcctggtggctctgtcatggttggaagcgttgggggccagcagactcct
aatcagccccagggccagcttccccttccacagcagcaacagcagccttctgctggccct
ccacaggcagcagtagagattgccatgaagatccaacaggtagccgatgctcagaggaaa
atggctctgcagagacaagccgccaaggccactgcaggcatgatgtcccctcaccatcaa
cagggtcaaggtcagcagatgggcgtggggcacccagggtcagtaggggtgggtggaccc
cagggcatccctccacagtcacaggcagcagtggctgctgctcgtgctcacatggatcag
caacaaggtgctgtgccggggatgatggggggccccatgcagcaaccccctcagcagggt
aacctgccccagggccagctcccccctcaggtgcagcttcaacagccgagaatgggtgca
ccactccaaaaccctcaacaacctcaacagcagtggactggtccggggatgccaccccag
cagagacaagctctgatgaaccaaatgggccattcagccatgatggcagctcagcagcag
cagcagcagcaacaggctcagggccatgctgccttgatgaatatggcacagcagcagcag
gggcccggggggggggtcgccgcgggatttggcgcagctgctgttctgggggctgctggt
gggaacatcccccaggcagccctccaggacctgttacgcactctgcgctcacctagctca
ccactccagcagcagcaagtcctcaacatcttgcgctctaatccacagctcatggctgct
tttattaagcagagagcctcaaaatacaagggggtgcaggggccccccggcggaccaggc
ggtgtaccaggaggtcctgggcccacaggggctcctgttggtaatgtcatggcagggggg
ggggcacagggggagatgaataaaaaagtggcagctctgcagcagcagcagcagcagcaa
caacaacaacaacaacagcagcagcagcaagggggagcaagaggcatacagggccagggg
ccacagatgggaaatctcaacaatcctcagtttagagagatgctcatgatacgacatctc
cagcatcagcaacagatgggagtgaatcatgggcagttccagcagccacagccaccgcag
ggccagggctacatgggacaacctggaatgcagcctcctactgtagggcagggcccacct
ggaggtccatctcttggctctcagcagcctggtggtgcccccggccagcagggacaaggt
tacccagggtcagtggcccagcagcaggccacagctgcactccagcagaggctccagcac
cagcaccatctccagatgcagcagcagaatgccatggctggcctgtcagggtgtgatgca
gggccaagtggaggagctgtaggaggtcctccgcagccccctcagggccctcagcccact
caaagtggccctccacctccatctactcaggccctgctccaacaggctctccaccagagg
ctgctccagcagcagcagcaacacctgggtgctggggggtcaccagcccagcacagcaac
cccatgagccctcagcagccacagcagatgtcccagtcgccacacccccacttgcagggt
caggccctgcccacatccctggctaaccaggtgcgatccccacagccttctcccaggccc
cagtcgcaaccgccacactccagcccgtccccacgcatgcagccccagccctcccctcat
cacatctccccccagatgcagaccagctccccacacccaggccacctgaaccagcaccac
ccgggtatggtggtccctccgcagcagcagcagcagcagaactctgtggagcactatggc
tcggaccagagcaccatgttatctcagatgagtggcatggccggtctccacaggccgggg
ggcaacagtcaggaccctttgggccagaacataaatcacaaccctttagacatcatatag

KEGG   Monopterus albus (swamp eel): 109952679
Entry
109952679         CDS       T05607                                 

Definition
(RefSeq) histone acetyltransferase p300-like
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04330  Notch signaling pathway
malb04350  TGF-beta signaling pathway
malb04520  Adherens junction
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109952679
   04330 Notch signaling pathway
    109952679
   04350 TGF-beta signaling pathway
    109952679
   04068 FoxO signaling pathway
    109952679
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109952679
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109952679
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109952679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109952679
   03036 Chromosome and associated proteins [BR:malb03036]
    109952679
   03029 Mitochondrial biogenesis [BR:malb03029]
    109952679
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109952679
Transcription factors [BR:malb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109952679
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109952679
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109952679
SSDB
Motif
Pfam: HAT_KAT11 Creb_binding zf-TAZ DUF902 Bromodomain ZZ Npa1
Other DBs
NCBI-GeneID: 109952679
NCBI-ProteinID: XP_020443529
LinkDB
Position
Unknown
AA seq 2602 aa
MAENVLDSGPPSAKRPKLSSPALSAFRQKNRVLVSSIGGLLSNGYFSQAVHKLSARPTYD
KVFGVLLGPNCQSASDFGSLFDLEHDLPDELISSNEPGLVNGGDLNQLHTTLGGGPAGMG
PGGGSGGAGGMGLGLGPGVGPGVVGGGQDAVAKHKQLSELLRSGAPTSTQQGHQGAMSSP
GVPAAMGQHLANMKASSGQGPQQMMGQGQQHLSPQQQANMMQQQQQNPAAGMMGNINRVM
MAVQQKGSNGQQQPSMIGGQVMNGSPRMGFGNQGIGGNSNLLAETLQQQGAGGQAGMRSQ
QPGAMSKMAMMGNPGGPFGGPYAAQGTPGLGSTGLGPQLQNKGPMANSLAQFNVDKKNQS
MQGMAAMGSQQSQASVGGPSGAPVGGAPGVVSNAQAGLVGPGPQGSAASAAAGAPPTADP
EKRKLIQQQLVLLLHAQECQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAH
CASSRQIISHWKNTMRVLLPQNFTDHTKRKKDKSFPDSVQTHAQLGHSHLSLYYGPLPDP
SMVRPTGPNQMVNRMPGPGMNQFSQMGMQAMGQRSMPPLSMGASGNQMGMAGPRMGQPNV
NQLQNQYLSQGQFPGSGPGVGTAQPGAQAGMAQTQMGTPPPFSVASPLAQPGSTGGPGGI
STVGPMAPQSVVGGVPNSAVGAPSSSITPSNMNQQPHSIPHLGAMRGSSPSPARSRSPTP
HQTPPRLTGSQTPQPHTPNAPQLAIPPAPQQNQLGQGPGSNKPLQQQHVGPAGSTTPSHP
GLASSSTPHGAQLPHTPLSQKGSFPPDSQALTPPSVNSLDTSSQGPQLDTSTANLDPKME
VKQQDEEEEESDTGSCSKGGKLSNLRMEEKPVKKEECSGEGGKGIPMDMSTVPTMDVKME
DRKPEVKKEVKEEEEMLGAAVPQVSVKKKIFKPEELRQALMPTLESLYRQDPESLPFRMP
VDPQLLCIPDYFDIVKNPMDLSTIKRKLDTGQYQDPWQYVDDIWLMFNNAWLYNRKTSRV
YKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYFSYQNRY
HFCEKCFNEIQGETVSLGDDPTQPQTSISKDQFEKKKNDTLDPELLVECMDCGRRMHQIC
VLHNETIWPLGFVCDGCLKKANKTRKENKHSAKRLPQTKLGCYLETRVNDYLKRQGNPES
GEVFIRVVHVSDKVVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEDIDGADVCFFGMHV
QEYGSDCPQPNQRRVYISYLDSVHFFRPRSLRTTVYHEILIGYLEYVKKLGYTTGHIWAC
PPSEGDDYIFHCHPADQRIPKPKRLQEWYKKMLDKAVAERIVHDYKDIFKQATEDRLTSA
KELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSNESIDDTKGDSKNAKKKNNKKTS
KNKSSLSRANKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPMANALPPIIDPDP
LMACDLMDGRDAFLTLARDKHLEFSSLRRSKWSSMCMLVELHNQSQDRFVYTCNECKHHV
ETRFHCTVCEDYDLCITCYNTKGHEHKMEKLGLGLDDESSSQAAATTQNPGDSRRLSIQR
CIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQ
ENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRVGQPTPGGAPGGNGLPSPGA
SNGAAGPGTPTSVGTQPPTPQTPTQGNLPALPQQQGAVMGGMGTPGQQQQVQQQGGTMPP
QHHIHQFQPVGGVSGGAMMNSPQQPMVPQLQQQPPSVQQLQQQQPGSLPPYNPRPPGASP
LHQSLGKPGLGPATPPQQQQPPNQGQGSIPVQGQQQGPPLAAVETALKIQRLAETQRQMA
QAQAQIRGLGQGGLIPQHPHQQNNQGQMGLPHIGAQGMPPQAQGVVGRTMLDPQQQGMLA
GMQQGGLQTQLPHQVQQQLQQVQQAGGGQLPPTNQQWGAGGPAMNPQQRPGMMGHMAPQQ
QPTVAQQQQQPMNPQQPPPGNRGLMQVMGGAGGAAGAPASLAAAAGAGNLPQAALQDLLR
TLRSPSSPIQQQQVLNILRSNPTLMAAFIRQRAARYQGGQGGAGGAVGPPQGGPGGIRFQ
GGVGGLPGVGGQGDGQQQINMNQAGQPGMNMVQGGVGGGNMPTMAQLQQLQQQRPMLPGN
LQQQQLAALQQQQQQGAMQAGQQGNMTPQFREMMRRHLQQHMGNHGQFQQPQGLQQQGQQ
AFMQPGQGQPGIPPSSQPQPGGESVGGPQQQGGPQGGPGQLGQQQGYSNSMSQVAAALQQ
RLQHPMQMQQQQQQQNSMGGLQGQDGGPGGVGGPGGPPLLPGQGGPGQGQQQQGGVGGGS
GGPTMPQVSQGMLHQNIHQRLLQQQQQQHLGGGSPAHHSSPMSPQQQMAHSPHHLQGQGG
LGPAGSLSSQVRSPQPSPRPQSQPPHSSPSPRMQPSQPQPSPHRISPQTQTGSPHPGHLS
QHHPSMAPAQPPQPQQQPGSSVDPGQSCLSDQNSIISQLSGMAGMHSGQGGQSDMLGGNS
NNSSNNNQELGTNMNHNTLDLM
NT seq 7809 nt   +upstreamnt  +downstreamnt
atggccgagaacgttctggactctggcccgccttcagccaagaggcctaaactctcatct
ccggcactttccgccttcagacaaaagaaccgcgtgctagtatcctcaatcggtggcctc
ttgtctaatggctactttagccaggctgttcataaactcagtgcgaggccaacttatgat
aaagtttttggtgtcttacttgggccaaattgtcagtcagcttcagattttggctcactg
tttgatttggagcacgatctcccagatgagcttatcagctctaatgaaccaggcctggtc
aatggtggggacctcaaccagctgcacactactctgggaggaggaccagcagggatgggt
cccggaggaggcagtggaggggcaggaggaatgggtcttggcctcggccctggagtaggt
cctggcgttgttggcgggggccaggatgcggtggctaagcacaagcagctgtctgagctt
ttgcgttcaggggcgcccacctcgactcagcaagggcaccaaggagccatgagcagccca
ggggtccccgctgctatggggcagcacttggctaacatgaaggcatcttctggccaggga
cctcagcagatgatgggccaagggcagcagcacctctctcctcagcagcaggctaatatg
atgcagcagcagcaacagaatcctgcagctggaatgatgggtaatattaacagagtgatg
atggcagtgcagcagaaaggcagtaatggacagcagcagccaagcatgatagggggccag
gtgatgaatggctcccccagaatgggctttgggaatcagggtataggtggcaacagcaac
ttgttggctgagaccctacagcagcagggagctggtggccaggccgggatgaggagccaa
caacctggagcaatgagcaagatggcgatgatggggaacccagggggcccttttggaggt
ccatatgcagcacaggggactccaggcctgggaagcacagggctgggccctcagctccag
aacaaaggccccatggccaacagcttggcccagttcaacgtggacaagaagaaccagtcc
atgcaaggaatggctgccatgggctcccagcagtcgcaggcaagtgtaggtggtccctct
ggcgcacctgtgggaggggctccaggtgtggtgtccaatgctcaggcaggtctggtgggc
cctggtccccagggttctgcggcgtctgctgcagctggtgcgccacccaccgctgaccct
gagaagcgcaagctaatccagcagcaactggtactcctgcttcatgctcaagagtgtcag
aggagagaacaagccaacggtgaagtccggcagtgcaacctgccccactgtcgcactatg
aagaatgtcctcaaccacatgactcactgccaggctggaaagtcttgtcaggttgctcac
tgtgcatcatcaaggcagatcatttcccactggaagaacaccatgcgagtcctgttgcca
cagaactttaccgaccacacaaaaagaaaaaaggacaaatcttttccagattctgtacaa
acacatgctcagttagggcattcccacctctctctctactatggtcccctccctgaccca
tcaatggtgcggccaactggaccaaatcagatggtcaacaggatgccaggaccaggtatg
aatcagttcagtcagatggggatgcaggctatgggccagaggtccatgccccctctctct
atgggagcatctggcaaccagatgggaatggctggacccaggatggggcagcccaatgta
aaccagctgcagaaccagtatttgtcccagggacagttccctggttcaggaccgggtgtt
ggaacagctcagcctggagcacaggcaggcatggcacagacacagatgggcactcctccc
cccttttcagttgctagtcctctagcacagccaggttcaactggtggtcccggtggcatc
tccacagtcgggccaatggccccccagagtgtggtcggtggggttccgaactcagctgtt
ggagctccatcttcctccataacgccatctaacatgaaccagcaacctcactccatcccc
catttgggagccatgcgcggcagctcaccctccccagctcgcagccgatcccctacccct
caccaaacaccccctagactaactgggtcccagaccccacagccacacacccctaatgca
ccacagctggctatacctccagccccccagcagaaccagcttggccagggtccaggctcc
aacaagcctctccagcagcagcatgtaggtccagcgggttcgaccactccgtctcaccca
ggactggcctccagctccacaccgcatggtgctcagctgccacacactccgttgtcccaa
aagggttcattcccaccagacagtcaggccctgactccaccctccgtcaacagcctggac
acttcttctcaggggccacagttggacacctcaactgccaacctcgaccccaaaatggag
gtcaagcaacaggacgaggaggaggaggagagcgatactggtagctgctccaaaggaggg
aagctcagcaacctcagaatggaggagaaacctgtgaaaaaggaggagtgttctggagaa
ggtggtaagggtattcccatggatatgtcaacagtgccgacaatggacgtgaagatggag
gacaggaagccggaggtgaagaaggaggtcaaagaggaagaggagatgttaggggcagct
gttccacaggtctcagtgaaaaagaagatcttcaagccagaagagctccgtcaggccctg
atgccaactcttgaatctctatacagacaagacccagagtcgctgcctttcagaatgcct
gtcgacccacaactgctgtgcatacctgactattttgacattgtgaagaaccccatggat
ttatcaactatcaagcgaaagctagacacaggccagtaccaggatccttggcagtatgtg
gatgacatttggttgatgttcaacaacgcctggttgtacaaccgcaaaacatcccgagtc
tacaagtactgctccaaacttgccgaggttttcgagcaggagattgaccctgtaatgcag
agccttggctattgctgtgggaggaagctggagttctctcctcagactctgtgctgctat
ggaaagcagctgtgcactattccccgagatgctacttacttcagctaccagaacaggtac
cacttctgcgagaagtgtttcaacgagatccagggcgagacggtttctctaggtgacgac
cccacccagccacagacatccattagcaaggatcagtttgagaagaagaagaatgacaca
ctggaccctgaactgcttgttgagtgtatggactgtgggcgcaggatgcaccagatttgt
gtcttgcacaacgaaacaatctggccattgggttttgtttgtgatggctgcctgaagaag
gcaaataaaacgaggaaggagaacaagcattctgccaaaaggttgccccagacaaagttg
ggctgttacctagagacaagggtgaatgactacctgaagcgtcagggcaacccagagtct
ggagaggtcttcattcgtgtcgtccatgtctctgacaaagtggtggaggttaaaccaggc
atgaagtccagatttgttgacagtggagagatgtcggagtctttcccatacaggacaaaa
gccctttttgcgtttgaggacattgatggagctgatgtctgcttctttggtatgcacgtt
caagagtatggatctgactgtcctcaacccaaccagagacgagtctacatctcctacctg
gacagtgtgcacttcttccggcctcgcagtctaagaacaacagtttaccatgaaatcctc
atcgggtacttggaatatgtgaagaagttgggttacaccactggccacatctgggcctgc
ccgcctagtgaaggggacgactacatcttccactgtcacccagcagatcagaggattcca
aaacccaaacgccttcaggagtggtacaagaagatgttagacaaggctgtggcagagcgg
atagtgcatgactataaggacatcttcaagcaggccacagaggatcgtttgaccagtgcc
aaagagttgccttactttgagggcgacttctggcccaatgtgctggaggagagcatcaaa
gagctggagcaggaggaggaggagaggaaaagagaggagaacagcacttccaatgagagt
attgatgacacaaaaggggacagtaaaaatgcaaagaagaagaacaacaagaagacgagt
aagaacaagagcagcctgagccgagccaacaagaagaagccagggatgcccaacgtctcc
aatgacctttcacagaaactctatgccaccatggaaaaacataaagaggtattctttgtg
atccggctgattgcaggccccatggcaaatgccctgccccctattatagatccagatccc
cttatggcctgtgacctcatggatggccgtgatgctttcttgacattggcccgagacaaa
cacctggagttcagctcgctaaggaggtctaagtggagctccatgtgtatgttggtggaa
ctgcataaccaaagccaggaccgcttcgtatacacttgtaatgagtgcaagcaccacgtg
gagactcgtttccattgtactgtctgtgaggattatgacctctgcatcacatgttacaac
actaagggccacgagcacaagatggagaagttaggccttggtttggatgatgaaagcagt
agtcaggctgctgccaccactcagaaccctggagactctcgtcgcctcagcatccagcgc
tgcatccagtccctcgtccacgcctgccagtgtcgaaatgcaaactgctctctgccatcc
tgccagaagatgaaacgtgttgttcagcacacaaaaggctgcaagagaaaaaccaatggt
ggctgccccatctgcaagcagcttattgcattgtgttgctaccatgctaagcactgtcag
gagaacaagtgcccagtcccattctgtctaaacatcaagcacaagctccgtcagcagcaa
ctgcagcacaggctccagcaagcccagatgctgaggaggaggatggccagcatgcagaga
gtgggccagccaactcctggaggagcccctgggggcaacggcctgccttctccaggagcc
agcaatggagcagctggtcctggtacccctacatctgtgggcacgcagcctccaacccca
caaacacccacccagggtaatttgcctgcacttcctcagcagcagggagctgttatgggg
ggaatgggaactccaggccagcaacagcaggtgcagcagcaaggtggtaccatgcctcct
caacaccatatccatcagtttcagccagtggggggagtaagtggaggggctatgatgaac
tctcctcagcagccgatggtgcctcagcttcaacagcagcctcctagtgtccagcaactc
cagcagcagcaacctggtagtttgcccccttacaaccccagaccaccgggagcctctccc
ctccatcagtccttggggaaacctggcctgggtccagccaccccacctcagcagcaacaa
ccacccaaccagggccaggggtcaattcctgtacaaggtcagcaacaagggccccctctg
gctgctgtagagactgccctaaaaatccagcgcctagcagagacccagagacaaatggcc
caagcccaagcccagatccgtggcttaggacaggggggcttgataccccaacatcctcac
cagcagaacaaccagggccagatgggcttgccccacattggggcccaaggcatgcccccc
caggctcaaggagttgttggcaggactatgttagatccacaacaacagggaatgctagca
gggatgcagcaaggcggccttcagacacagttgccccatcaagttcagcagcagctccag
caagtccagcaggcagggggtggacaactgccaccaacaaaccagcaatggggtgctggg
ggaccagccatgaacccccagcaaaggccaggcatgatgggtcacatggctccacagcag
cagccaacagttgctcagcaacagcagcagccgatgaatccgcaacaaccaccaccagga
aaccgtgggctgatgcaggtaatgggcggagcaggaggggcagcaggggcacctgcttca
ttagcagctgcagctggagcaggaaacctgccccaggcggcactgcaagacctcctgcga
acactgcgttccccaagctcacccattcaacagcagcaagtcctcaacattcttcgttcc
aacccaacccttatggctgcttttattagacaaagagcagccaggtatcaaggcgggcag
ggtggtgctggaggagcagtagggcctccacaagggggccctggaggtataaggttccaa
gggggtgttggagggctgcctggtgtaggagggcaaggggatggacagcagcagattaat
atgaaccaagctggacagccagggatgaacatggttcagggtggagtagggggagggaat
atgcctaccatggctcagcttcagcagttgcaacagcagcgcccaatgctacctgggaat
cttcagcaacagcaattggctgcattacaacagcaacagcagcagggagcaatgcaggca
gggcagcaaggcaacatgactccacagttcagagagatgatgagaagacacctgcaacag
cacatgggaaaccacgggcagttccagcagccacaaggactccagcagcaaggccagcaa
gcctttatgcagcctggtcagggacagccaggaatacccccctcttcacaaccccagcct
ggaggagaaagtgtagggggtccacagcagcaaggaggaccacagggtgggccaggacaa
ctaggccagcagcagggctactcaaactccatgtcacaagtagctgcagcgctccagcaa
aggctccagcatccgatgcagatgcagcaacaacagcagcagcaaaattcaatgggtggg
cttcaaggacaagatggagggcctggtggagttggaggaccaggaggacctccacttctg
cctggccaaggtggaccagggcagggacaacaacaacaaggtggagttggcggagggagt
ggtggccccacaatgccgcaggtgtctcaaggcatgcttcaccagaacatccaccagagg
ctcttgcagcagcagcagcagcagcaccttggtgggggctctccagcccaccacagcagt
cccatgagtccccaacaacagatggctcattcccctcaccacctccaaggacagggagga
cttggtccagcaggatcactcagcagtcaggtcaggtcaccacagccctcgccaagacca
cagtcgcagccaccacactccagcccttccccgcgcatgcagccctctcagccccagcca
tcacctcatcgcatttctccgcagacccagactggctcaccccacccgggacacttaagc
caacatcaccccagcatggcaccagcccagcctccacaacctcagcagcagccaggtagt
tctgtagatcctggtcagtcctgcctctcggaccagaattcaatcatatcccagttgagt
gggatggcagggatgcacagtggacagggggggcagtcggacatgttgggtgggaatagt
aacaacagcagcaacaacaaccaggagcttggaacgaacatgaatcacaacactttagac
cttatgtag

KEGG   Monopterus albus (swamp eel): 109972268
Entry
109972268         CDS       T05607                                 

Definition
(RefSeq) CREB-binding protein-like
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04330  Notch signaling pathway
malb04350  TGF-beta signaling pathway
malb04520  Adherens junction
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109972268
   04330 Notch signaling pathway
    109972268
   04350 TGF-beta signaling pathway
    109972268
   04068 FoxO signaling pathway
    109972268
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109972268
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109972268
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109972268
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109972268
   03036 Chromosome and associated proteins [BR:malb03036]
    109972268
   03029 Mitochondrial biogenesis [BR:malb03029]
    109972268
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109972268
Transcription factors [BR:malb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109972268
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109972268
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109972268
SSDB
Motif
Pfam: HAT_KAT11 Creb_binding KIX zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 109972268
NCBI-ProteinID: XP_020476658
LinkDB
Position
Unknown
AA seq 2155 aa
MAENLLDVGPPNSKRPKLNSPALSASDGQDLGSLSWDDLENDLPDELIPNGGDLGMMGGM
PSNGGATPGPGGPVVAPAGLGSVGSPVVQDAAAKHKQLSELLRAGSTSSIAGTGLSSASP
QPGGMGSQLGTPLGKSPLSQGSPNNHPSPQAQKAGTPTGVTGQNNNNNAAAMGLNTTGFN
QAMINNSQGHAGLLTQGGQPQPGQVMNGGLGPGAGRGRGAGVAGMQYQGAAPGPVGAGSA
LAETLTQGGQQMGAHATLAAAQQAGNMNKMSLGSNGGPFGPQPYGQGAAGPGQQLNPQQQ
LQNKASLANSLPPFPSELKGAPVTSVPNMQLQQQPQQQAAMLPLAGGGGVSVPSAGPTAD
PEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVA
HCASSRQIISHWKNCTRHDCPVCLPLKNASDKRTQQPMLNSPNTGLQNPMSSVGVGQPSA
PTINTSAPIDPSSMQRAYAALGLPYSSQATGQAPGPGQTAGAQSTQAQQQQLSQQMRPIN
ALGNQMTLGGATMGVTTSEQTNLHTDSLPNTLNTNNQLLSDGSAVGSLGNLPTAAPISAT
GTRKAWHEHVTEDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANS
RDEYYHFLAEKIYKIQKELEEKRRSRLQKQIINQAPMAAQGTQQPGIPQPNALGPRPQNG
PVLLPNMPNQIMNRMQVSQGIGQFNHMALPTTQISQAPMGARAASPMNHPQQMNMSSVPA
MGMSPSRMPQAQSMLGGHSGGNMVGQTASQGQFLAQTQFPPGSSTVAATGAMNVTVGPGM
GQLQAQAAVTQLSQPGASLDNRVPTPASAASADLHSQHVGADLPVQEVKTETHHDHQPEF
EAAGGKTEPKMETEDDSASMLVKKEESEEKPEPMEVEEKKPEIKTELKEEEEGGANSTTS
SSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPID
LSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQ
SLGYCCGRKYEFSPQTLCCYGKQLCTIPTGGTYYSYQNRYHFCEKCFNEIPGESVTLGDD
PAQPQTMISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICDNCLKK
SGKTRKENKFSAKRLQSTRLGMYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPG
MKARTKALFAFEEIDGVDVCFFGMHVQEYGSECLFPNNRRVYISYLDSIHFFRPRILRTA
VYHEILIGYLEYVKKLGYAQGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLD
KAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEEN
TAASETPEGTPSDSKNAKKKNNKKTNKNKSSVSRANKKKPGMPNVANDLSQKLYATMEKH
KEVFFVIHLHSGPMVNTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRCKWST
MCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLG
LDDDNNSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGC
KRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQLMRRR
MAMTMQGRTMPLPSPPASAAPSTPTSHTQPNTPQTPQQPLSNQPQTPNSAGVMSPSFPNA
PRNGQTQAPVSQGKPGPQASPLHQQQSPLPQPPQLHLPLSPNSRNAIPQVIPPGMAPGQW
PGAAGPMQAAQTQQPGLVPGQTPQQAMTMQRAMMPPGQQPQQGQRMLIPQQPGARAQTPQ
RPGAIAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYHANQPQQQQ
QAGQQQQPGMVAMQAMAMPGGAVQRPGIPPQQPQQPPAQGMAALGPQGQMMNAAHNTNPQ
IQELYRRQVLRQQQQQQQQQQQQQQQGMMAQGHPGQFPAQAQGTAATYSQLHMQQQQIAT
QAGTGAAGGPMGQLPPLTQMAQPGMGMDSTQNLLHQRMLQQQQQPPQQQQAVLKQ
NT seq 6468 nt   +upstreamnt  +downstreamnt
atggctgaaaacctgctggacgtcggacctcccaactctaagcggccgaagctgaattca
cctgccctgtcggcgtccgatggacaagatctagggtcactatcctgggatgatttggag
aatgaccttcctgatgagttgatccctaatggaggagatctgggtatgatgggtggaatg
ccttcaaatggtggggcaacacctggacctggtgggccagttgttgccccagcaggcctt
ggcagtgttggttccccggttgtccaggatgcagctgccaagcacaagcagctctcggag
cttcttcgagctggtagcacttccagtattgcaggcacaggactgagctcagctagccct
cagccaggtggtatggggtctcagttgggcacaccgcttggtaagagcccccttagccag
ggctccccgaacaaccatccatccccccaggcccaaaaagcaggaacaccaacgggagta
acaggacagaacaacaacaataatgctgcagcaatgggcttgaacacaacaggattcaac
caggccatgattaacaatagccagggtcatgctgggctcctaacccaggggggccagccc
caacctgggcaagtgatgaacggtggtctcggacctggagctgggagaggacggggtgca
ggagtggcaggcatgcagtaccagggagccgcaccaggaccagtgggagcagggagtgct
ttggcagagacgctcacccaaggcgggcagcagatgggagctcatgccaccctcgccgca
gcccagcaagcaggcaacatgaacaaaatgagcctgggcagcaacgggggtccatttggg
cctcagccttacggtcagggtgctgcagggcctggccagcagctaaaccctcagcagcag
ctccagaacaaagcttccctcgccaacagcctgcctcctttccccagtgagctcaaaggg
gctcctgtcactagtgtgccaaacatgcagcttcagcagcagcctcagcagcaggcagcg
atgctccccctggctggcggcggaggtgtgtcggtgccttcggcaggccccacagctgat
ccagagaagcgcaagctgatccagcagcagctggtcctgctgcttcatgcacacaagtgc
cagcgacgggagcaagccaatggggaggtgagggcctgtgccctgcctcactgccgcacc
atgaagaacgtcctcaaccacatgacccactgccaggctggcaagtcctgccaggtggct
cactgtgcgtcatccagacagatcatctcccactggaaaaattgcacacgacatgactgt
cccgtctgcctgccgctgaagaacgccagtgacaaacgcacccagcagcccatgctgaac
tctcccaatacgggcctccagaaccccatgtcctcagttggtgtgggccaacctagtgct
cccaccatcaatacctcagcccccatagaccccagctccatgcagagagcctatgcagca
cttgggctgccatacagcagccaggccactgggcaggcccccggcccaggacagacggca
ggggcacagagcacacaggcccagcaacaacagctttcgcagcagatgagacccatcaat
gcacttggtaaccagatgactctaggaggtgcgacaatgggcgtgaccacttcagaacag
acaaacctgcacacagactcccttcccaacacactcaacactaacaatcagctgctgtca
gatgggtcagctgtgggatcactgggcaacctacccacagcagcacccatctctgctaca
ggcaccagaaaagcctggcatgagcacgtcactgaggacctgcgcaatcacctggtacac
aaactagtacaagccatatttcctacccctgacccggcagctctcaaggacaggcgaatg
gaaaacctggtggcttatgccaggaaggtggagggggatatgtacgagtcagctaacagc
cgggatgagtactatcacttcctggctgagaaaatatacaaaatccaaaaggaactggag
gagaagaggcgctcaaggctacagaagcagatcatcaaccaggcacccatggctgcccag
ggtactcagcaacctggtattccccagcctaatgccttgggcccacggccacagaatgga
cctgtacttctgcccaacatgccaaatcagatcatgaatcgcatgcaagtttcacaagga
atcggccagttcaaccacatggctctgcctaccacccagatatcccaggcacccatggga
gctcgagctgcttctcccatgaaccatccacagcaaatgaacatgagctctgttccagcg
atgggcatgtctccctccagaatgccgcaggcccagagcatgttgggtggacacagcggc
ggcaacatggtgggccagacggccagccagggacagtttctggctcagacccagttccct
ccaggatcttctacagttgctgcaacgggtgctatgaatgtcactgtggggcctggcatg
ggtcagctacaggcccaggctgctgtcacccagctgtctcaacccggagccagtctggat
aaccgggtgcccacgccggcctcagctgccagcgctgacctgcactcacagcatgtcgga
gcggacctgccagttcaggaggtcaaaacagagactcaccatgatcatcagccggagttt
gaggccgctggcggcaaaactgagcccaagatggagactgaggatgactctgcttcaatg
ctggtgaaaaaggaggagtcggaggaaaagccggagccaatggaggtagaggagaaaaag
ccagaaatcaagacagaactgaaagaagaggaggagggtggggccaacagcacaacgtcc
tcatcgccctctcaatcacggagaaaaatctttaagcctgaggagttgcgccaggctctg
atgccgacgttggagtctctctacaggcaggatcctgagtccttgcccttcagacaacca
gtggatcccatgcttctgggtatcccggactactttgacattgttaagaacccaatagat
ctatccacaataaagcgtaagctcgacacgggccaataccaagagccctggcagtacgtt
gacgatgtctggctgatgttcaacaatgcttggctctacaaccgcaagacgtcacgtgtc
tacaagtattgttccaaactggccgaggtgtttgagtcagagatcgaccctgtcatgcaa
agcctgggctactgctgcgggaggaagtacgagttctcccctcagaccctgtgttgctat
ggcaagcagctctgcaccatacctactggaggcacatactacagttatcagaacaggtat
catttctgtgagaagtgcttcaatgagatcccgggggagagtgtgacgttaggagatgat
ccagcacagccacaaacgatgatatcaaaagaccagtttgagcggaagaagaacgatgtt
ctcgaccctgaaccgtttgttgaatgtaaagattgcggacggaagatgcaccagatatgc
gtcttacactacgaggtcatttggccatctgggttcatctgtgacaactgtttgaagaag
agtggaaaaacaaggaaggaaaacaagttctcagccaaaaggcttcagtcgacacgcttg
ggaatgtacatagaagaccgtgtgaataaatacttgaagaggcaaaaccacccagaggca
ggagaggtgtttgtgcgggtggtggcgagctccgacaaaacggtggaagttaaaccaggc
atgaaagccagaaccaaagcacttttcgcctttgaggagattgatggtgtggacgtttgc
ttttttggcatgcacgtgcaggagtatggctccgagtgtctattccctaataataggcgt
gtctacatatcataccttgacagtattcacttcttcagacctcggattctacgaacagca
gtgtaccatgagatcctcatcggctatctagaatacgtcaagaaactcgggtacgcccag
ggccacatctgggcatgtcctcccagtgaaggagatgactacatcttccactgccatccc
ccagatcagaagatcccaaagcctaaaaggctgcaggaatggtacaggaagatgctggac
aaggcctttgcagagaggattcttcatgactataaggacatcttcaagcaggcaacagag
gacagactgaccagtgcaaatgagctgccctacttcgaaggcgacttctggcccaacgtg
ttggaggagagcatcaaggagctggagcaggaggaggaggagaggaagaaggaggagaac
acagctgcttctgaaacccctgagggtacgccaagtgacagcaaaaacgcaaagaaaaag
aacaacaagaagaccaataaaaacaagagcagcgtgagccgagccaataagaagaagcct
gggatgccaaatgtagcaaatgatctgtcccagaagttgtatgccaccatggaaaagcac
aaagaggtgttctttgtgatccaccttcactctggtcccatggtcaataccctgccacct
attgttgaccccgaccctttgctctcctgtgacctgatggacggccgtgatgccttcttg
actctagccagggacaagcactgggagttcagctccctcaggaggtgcaagtggagtacc
atgtgcatgctagttgagctgcacaaccagggacaggaccgctttgtttacacttgcaac
gagtgcaagcaccatgtggagacacgctggcactgcactgtgtgtgaggactttgatctt
tgcatcaattgttataacacgaagggccacgaacaccagatggtgaagtggggtcttggc
ctggatgacgacaacaacagccagagtggagaggcctccaagagtccacaggagagccgg
cgtctaagtatccaacgctgcatccagtccctggtccacgcttgtcagtgtcgcaatgcc
aactgctctctgccatcctgccagaagatgaagcgagtggttcaacacaccaagggctgc
aagcgcaaaaccaatggtggctgtcctgtatgcaagcagcttattgctttatgctgttac
catgcaaagcactgtcaggagaacaagtgtcctgtcccattctgcctgaacatcaagcac
aagcttcgccagcagcagctgcagcacagactccagcaggcccagctgatgaggcgaaga
atggccatgaccatgcaaggcagaaccatgccgctaccatccccgccagcctcagctgcc
cccagcacgcccacttcccatacccaacctaacactccccagacaccccagcagccactt
tccaaccaaccacagacgcccaactcagcaggtgtcatgtctccctcttttcctaatgca
cctcgcaatggccaaactcaagcaccagtttcccagggcaaacctgggccccaggcctcc
cctctacaccagcagcagtcccctctcccccagccaccgcagctacacctgccgttatca
ccaaattccagaaatgctattccacaggtcataccacccggcatggccccaggacagtgg
cctggagctgcaggacctatgcaagcagctcaaactcaacaaccgggccttgtcccaggc
cagaccccacagcaggccatgaccatgcagcgagccatgatgcctcctgggcagcaacct
cagcaaggccagaggatgctaataccacagcagcctggtgcccgggcacaaacaccgcaa
agacctggtgctatagcccccaatgccctgcaggaccttctccgcaccctcaagtctccc
agctcaccccagcaacagcagcaagtcctcaacatcctcaaatcaaaccctcagctaatg
gctgctttcatcaaacagcgaacagccaagtaccatgccaaccagccgcagcagcagcag
caagcgggtcagcagcagcagcctggcatggtagcaatgcaggccatggccatgccagga
ggggcggtacagaggccagggataccccctcagcagccccagcagcctcctgcgcagggt
atggcagcattagggcctcaagggcaaatgatgaatgcagctcacaacaccaacccccag
atccaggagctttaccgtcgacaggtgttaagacagcagcagcagcagcagcaacaacaa
caacaacaacaacaacagggaatgatggctcaaggccaccctggccagttccctgctcag
gcacagggtacagcagctacttactcccagctccacatgcaacagcaacagatagccacg
caggcaggcacaggagcagctggtggacccatgggccagctcccgcccttgactcagatg
gcacagcccggtatggggatggactccacccagaacttgctccatcagcgaatgcttcag
caacagcagcaacctccccagcagcagcaggctgtcctcaagcagtag

KEGG   Monopterus albus (swamp eel): 109972897
Entry
109972897         CDS       T05607                                 

Gene name
crebbp
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04330  Notch signaling pathway
malb04350  TGF-beta signaling pathway
malb04520  Adherens junction
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109972897 (crebbp)
   04330 Notch signaling pathway
    109972897 (crebbp)
   04350 TGF-beta signaling pathway
    109972897 (crebbp)
   04068 FoxO signaling pathway
    109972897 (crebbp)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109972897 (crebbp)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109972897 (crebbp)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109972897 (crebbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109972897 (crebbp)
   03036 Chromosome and associated proteins [BR:malb03036]
    109972897 (crebbp)
   03029 Mitochondrial biogenesis [BR:malb03029]
    109972897 (crebbp)
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109972897 (crebbp)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109972897 (crebbp)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109972897 (crebbp)
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109972897 (crebbp)
SSDB
Motif
Pfam: HAT_KAT11 KIX zf-TAZ DUF902 Bromodomain ZZ KIX_2
Other DBs
NCBI-GeneID: 109972897
NCBI-ProteinID: XP_020477778
LinkDB
Position
Unknown
AA seq 2064 aa
MADNLLDVGPPTAKRPKLNSPLSGSDGPDLVSLFDLENDLPDELIPNGDLGMGMSSNGGP
GGGGPGLNSIVPDAAAKHKQLSELLRPGSSSVLGGGLNSAGPQQGGMVGSQLGAVLGKSS
LGQGSPSHQSPQAQKGSVAGQGNGGAGMAFNQAMLNSGQAHGVMSQTGQVMNGALGPAGR
GRPGPGMQYQTQGMQGAQVGAGPGVGGSVLAETLTQGGPQLGAHNTLNAQQAGNLNKMGM
SGAQFGQQYGQTGVQQMGSAGVTAQQLQNKTVLSNNLPQFPADLKLTVPNMSQMQQHVAS
VGMVPVAGGVATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEMRACTLPHCRTMKN
VLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQPMLNSPG
TGLQNAISTVGPGQPSATAINSAATHIDASSMQRAYAALGLPYGNQSPAQVQGQGQGPVQ
QNPQGPQHQQMRNLNPLGTNQMNQMAGGMGVPSSDQTGMHSDSSLPSTLNNQLMPDGSVA
GGMGNLPATTPLSVTGVRKAWHEHVTQDLRTHLVDKLVQAIFPTPDPAALKDRRMENLVA
YARKVEGDMYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQPGMVGPAVPQQPGMA
QPNAMGPGQTVRPPNGPVPMPNMPNQIMNRMPVPQGINQFNPMAMPNAQMSQAAMGAHAP
PPMNHPQQMNMSSVPTMGMSPSRVSQTQGMMGGHANNMVSQPTNQGQFLQQGQFPATAGG
AMNVNVGLGQPISQAAVTQQPQNSNLPLNALGSLGSQLPCGPTAQPTLGTTPPPNSSASL
QPHQQLQQHHVPTQAQVPPQPSTPASTDGPSSTPTHIPSNLPGPPSAMNTPPDPSQPLTP
LQPLPEHPSQMQQPTSIQAQHPSTPLSQAAASIDNRVPTPGSVAELSSQQALPDSSGTEA
KTEVKDEEEDSNSGKKQIDVKMEDDETKPPVVKKEEPDATEPKQEPMETEEKKPVLKAEP
KEEESGANGTSTTSSTTQNRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPMLLG
IPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVEDVWLMFNNAWLYNRKTSRVYKYCTKL
AEVFELEIDPVMQGLGYCCGRKYEYSPQTLCCYGKQLCTISRDGTYYSYQNSSPKYGLIA
DRYHFCEKCFNEIQGNSVTLGDDPAQPQTMISKDQFEKKKNDMLDPEPFVECKDCGRKMH
QICVLHYEVIWPSGFICDNCLKKSSKTRKENKFSAKRLQSTRLGTYIEDRVNKYLKRQNH
PEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMVESFPYRTKALFAFEEIDGVDVCFFG
MHVQEYGSECPFPNKRRVYISYLDSIHFFRPRVLRTAVYHEILIGYLEYVKKLGYVTGHI
WACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERIIHDYKDIFKQATEDRL
TSANELPYFEGDFWPNVLEESIKELEQEEEERKKEENTASSEMTEGAHADSKNAKKKNNK
KTNKNKSSVSRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIMD
PDPLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECK
HHVETRWHCTVCEDYDLCINCYNTKGHEHQMVKWGLGIDDDNSQGGEASKSPQESRRLSI
QRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKH
CQENKCPVPFCLNIKHKLCQQQLQHRLQQAQMMRRRMATMAGRGMPMPSPPTSAAPDTPN
SVQQPKTPQTPQPMPSQPQQQQPPNPANIAQGFSNSGRNSQPPTPIPQGKPGPLSPLHQQ
QSPLPNMPQHGCQQQPQPFFCQKQQPLLAALKMARQIEMATKAKQQQQQQQQNYAMNGMP
MNHSRMMGPMQGQMQMMQGPRGPQVMPAMQQGSGNSHAPARPAHAEAHDAPTAGSPNAWG
HASPGAFTAGHDTTAAKHAPGNAW
NT seq 6195 nt   +upstreamnt  +downstreamnt
atggctgacaatctgctggatgtcggaccccccactgcaaagcgacccaagctcaattcc
cctctctcaggatcagatggcccagatcttgtgtctctgtttgacctggaaaatgacctt
ccagatgaactcatccccaatggagacctgggaatgggaatgtcctctaatggtggccca
ggtggaggcggacctggtcttaactccattgttcctgatgcagctgccaaacacaagcag
ctgtctgagctcctgcgaccaggaagttcctctgtcttgggagggggtctaaactctgct
ggcccccaacagggaggcatggtgggaagccagctaggtgctgtcctaggtaaaagctca
ctggggcagggctcccccagccaccagtctccccaggcccagaaaggaagtgttgctgga
caaggcaatggaggtgcaggcatggcctttaaccaggccatgttgaacagtgggcaggct
catggggtcatgagccaaacgggacaggtgatgaacggggctctgggaccggcaggccgg
ggaagacctgggcctggcatgcagtatcagacccaaggcatgcagggggcacaagtgggt
gctggacctggtgttggaggcagtgtgctggcagaaacactcacccaaggagggccacag
ttgggtgcacacaacacattgaatgctcagcaagctggaaacctgaataagatggggatg
tcgggagctcagtttggccagcagtatggtcagactggggtgcagcagatggggtcagcg
ggtgtcaccgcccaacaactccagaacaagacagtcctttcaaacaacctgccccaattc
cctgctgaccttaagctgactgtgccaaacatgtcacagatgcagcagcacgtggcatca
gtgggcatggtccctgtggctggtggcgtggcaacaggtccgacggctgaccctgagaaa
cgcaaactcattcagcagcagctggtcctgctgctccatgcgcacaagtgccagcggcgg
gagcaggccaacggggagatgagggcctgcactttgccccactgccgcaccatgaagaac
gtcctcaaccacatgacccactgccaggctggcaagtcctgccaggttgctcactgtgca
tcatccagacaaattatctcccactggaagaactgtacgcggcatgactgtccagtctgc
ctacctctgaagaatgccagtgacaagaggaaccagcaacccatgcttaattcccctggg
actggtctgcagaacgccatcagcacagttggacctggccagcccagtgccacagccata
aacagcgctgccacgcacatcgacgccagctccatgcagagggcctatgctgcccttggc
ctgccatatgggaaccagtcccctgctcaggtccaggggcagggccagggtccagttcag
cagaacccccagggcccccagcaccagcagatgcgaaatctgaacccactaggcactaat
caaatgaaccagatggcaggaggcatgggtgttccctcttcagaccagaccgggatgcac
tccgactcctctttaccctccacactcaacaatcagctgatgccagatgggtcagtagca
ggaggcatgggaaacctgcccgctactacccctctctctgttacgggggtaaggaaggcc
tggcatgaacacgtcactcaggacctgcgcacccacctagtggacaaactagtacaagcc
atattccccaccccagaccctgcagcactgaaggaccggcgaatggagaacctggtggcg
tatgcacgcaaagtcgagggtgacatgtacgagtcggctaacagcagggatgagtattac
cactttctggccgaaaaaatctacaagatccagaaggaactggaggagaagagacgctca
cggctccagaaacagcctggcatggtgggcccagctgtgccccaacagcctggtatggct
cagcccaatgctatgggcccaggacagactgttcgaccacccaatggacctgtgcccatg
cccaacatgccaaatcagataatgaaccgtatgccggtgccccaaggaatcaatcagttt
aacccaatggcaatgccgaatgcacagatgtctcaggcagccatgggagcacatgctccc
ccccccatgaaccatccacagcagatgaacatgagctccgtcccaacgatgggcatgtcc
ccatcaagggtatctcagactcaagggatgatgggtggtcatgccaataacatggtatct
caaccaaccaaccagggccagttcctccaacaaggccagttccctgcaactgcaggtggt
gcaatgaatgtgaatgtaggcttgggccaacccatatcacaggctgctgtcacacagcag
ccacagaactctaacctccctctgaatgcactgggctctcttggctcccagctgccctgt
ggccctacagctcagcccaccctgggtaccactcctccacccaattcctctgccagcctg
cagcctcaccagcagcttcagcagcaccatgttcccacgcaggcccaggtgccacctcag
ccctccacccctgcctccacagatgggccctcctccaccccaacccacatacccagtaac
ctccctggtcccccctcagccatgaatacaccgcctgacccctcccagccgctcacaccc
ctgcagcccctacctgaacaccccagccagatgcagcagcccacctccatacaggcacag
caccctagcacaccgctgtcccaggcagcagcaagtatagacaacagagtgcccaccccg
ggctccgtcgctgagctgagctcccagcaggccctgcctgactcaagtggcactgaagcc
aagactgaagtaaaagatgaagaagaagacagtaactctgggaagaagcagattgatgta
aaaatggaggatgatgaaaccaaacctccagtggtgaagaaggaggaaccagatgcaaca
gagccaaagcaggaaccaatggaaactgaggagaagaagccagtgttgaaggcagaaccc
aaagaagaggaaagtggggccaatggcacatcaaccacctctagcaccactcagaaccgc
aaaaaaattttcaaaccagaggagctgagacaagctctaatgccgacacttgaggccctc
tacaggcaagacccagagtcgctgcccttcagacaacctgtggaccccatgctattgggc
atccctgactactttgacatagtgaagaatcccattgacttatccaccatcaagcgcaag
ctggacacgggtcagtaccaggagccatggcagtatgtggaggatgtgtggctcatgttt
aacaatgcctggctgtacaatcgtaaaacatcccgcgtctacaagtactgcaccaaactg
gcagaagtgtttgagttggagattgaccccgtcatgcagggcctgggctactgctgcggc
aggaagtatgagtactcaccccagacactgtgttgctatggcaaacagttgtgtactatc
tcccgggatggcacctactacagctaccagaacagttcacccaaatatggccttattgct
gacaggtatcacttctgtgagaagtgcttcaatgaaatccagggcaacagtgtaaccctg
ggggatgacccagcacagccgcagaccatgatatcaaaagatcagtttgagaagaagaaa
aatgacatgctggaccctgaaccgtttgttgaatgcaaagactgtggacgaaagatgcat
cagatctgcgtgctgcactatgaagtcatttggccatcgggctttatctgtgacaactgt
ctgaagaagtctagcaaaacaagaaaggaaaacaagttttcagccaaacggctgcagtct
acaaggttggggacatacattgaggacagagtgaataagtacttgaaaaggcagaaccac
ccggaagctggtgaggtgtttgtgcgagtggtagccagctctgacaaaactgtggaggtt
aagcctggcatgaagtccaggtttgtagactcaggcgagatggtagagagcttcccgtac
agaactaaagcactttttgcatttgaggaaatagatggtgtagacgtttgtttctttggc
atgcacgtacaggaatatggctcggagtgtccctttccaaataaaaggcgggtttacata
tcataccttgacagtattcacttcttcagaccacgcgtgctgaggactgcagtgtaccat
gagatcttaataggctacctggagtatgtgaagaaacttggatatgtgacaggtcacatc
tgggcctgcccacccagtgaaggagatgactacattttccactgccaccctcctgaccag
aagattcccaagcccaagaggctccaagagtggtacagaaagatgctggacaaggctttt
gctgagaggattatacatgattacaaggacattttcaagcaggcaacagaagacaggcta
accagtgccaacgagttaccatactttgagggtgacttttggcctaatgtactggaagag
agcatcaaggagctagagcaagaggaggaggaaagaaaaaaggaggagaacacggcctcc
tctgagatgacagagggagcccacgctgacagcaagaatgccaaaaagaagaataacaag
aaaaccaacaaaaacaagagcagcgtcagccgagccaataagaaaaagcctgggatgccg
aatgtagccaatgatctgtcccagaagctctacgccacaatggagaagcataaagaggta
ttttttgttatccacctccatgccggtccagtcattaacacccttccacccatcatggac
cccgaccctctgttgacctgtgacctgatggatggccgtgatgccttcttgactttggcc
agggacaagcactgggagttcagctctctgagaagatgcaaatggagtacgatgtgtatg
ttggtggagctgcacaaccagggccaggaccgctttgtgtacacttgcaatgagtgcaag
catcatgtggagactcgctggcactgtactgtttgtgaggactacgacctatgcattaac
tgctacaacactaagggccatgagcaccagatggtgaaatggggtctgggtatcgatgat
gacaacagccagggtggggaggcttcaaagagccctcaggagagccggcgtctcagcatt
cagcgctgtattcagtccctggtccatgcctgtcagtgtcgcaatgccaattgctctttg
ccttcatgccagaagatgaagagagtggttcagcacacaaagggctgcaagcgcaagaca
aatggtggctgccctgtgtgcaagcagctcattgctttatgttgttatcatgccaagcac
tgtcaggagaacaagtgtcctgttcccttctgtctcaacatcaagcacaaactctgtcag
cagcagctgcagcacaggctgcagcaggctcaaatgatgcgccgcagaatggccactatg
gctggaaggggtatgcccatgccatctccacctacctcagcagctcccgacacccccaac
tcagtacagcagcctaaaacaccccagaccccccagcccatgcccagccaaccccaacag
cagcagccaccaaaccctgccaatattgcccaaggcttctccaacagtggccgaaacagc
cagcccccaacaccaatcccacagggcaaaccagggcctctgtcccctcttcatcaacag
cagtcacctctgcctaacatgccacagcatggctgccaacagcagcctcagccttttttt
tgccagaaacagcagccattgctggcagctctgaagatggccaggcagattgagatggca
accaaggcgaagcagcagcagcagcagcagcagcagaattatgccatgaatggaatgccc
atgaaccactcacgaatgatggggcccatgcagggccagatgcagatgatgcagggacca
cggggcccccaggtgatgccagctatgcagcagggctcagggaactcccatgccccagca
aggccagctcatgcagaggcccatgatgccccaacagcagggtctccaaatgcctggggt
catgcctccccaggggccttcacagcagggcatgacaccacagcagcaaaacatgccccg
gggaatgcctggtaa

DBGET integrated database retrieval system