KEGG   Monopterus albus (swamp eel): 109952674
Entry
109952674         CDS       T05607                                 

Definition
(RefSeq) mitogen-activated protein kinase HOG1-like
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109952674
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109952674
   04114 Oocyte meiosis
    109952674
   04115 p53 signaling pathway
    109952674
   04218 Cellular senescence
    109952674
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109952674
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109952674
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109952674
   03036 Chromosome and associated proteins [BR:malb03036]
    109952674
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109952674
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109952674
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109952674
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109952674
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 109952674
NCBI-ProteinID: XP_020443523
LinkDB
Position
Unknown
AA seq 256 aa
MEGYVKDPSRPVIGTGSFGVVYRVKSLRTQEEFALKCHACKVDDSTVRELSCLAALRGHP
NIIQLLDCFVSDEDRMAMLMPCLPFTLSCAIYTSAGVPLSFVASFSRQTANALAYVHRLN
LVHRDIAPNNLLLAEDLTVKVADFGLARQVSKRMSLNVVTEPYRAPEIFAARSDYTCAID
MWSLGAVIADAMESKVTFLPPPSTLQMITELAPDPGDLVGDDIVTRNREKLMPKLMRCEP
VKRISRNLEAPRSGAV
NT seq 771 nt   +upstreamnt  +downstreamnt
atggaaggatatgtgaaagatccctcgcgtcccgttatcggaacgggatccttcggtgta
gtttacagggtaaagtctctgcggacccaagaggagtttgctctaaaatgtcacgcgtgc
aaagtggacgactccaccgtgagagaactttcgtgcctcgcggccttacggggtcatcct
aatattatccaactgcttgattgtttcgtgtccgacgaggatcgcatggctatgctcatg
ccttgtctacctttcacgctgagttgtgcgatttatacctccgcgggggtcccgctgagc
tttgtggctagtttctccaggcagacggctaacgcgttggcctacgtacacaggctcaac
ctcgtacacagagacatcgcgcctaacaacctgctgctcgcggaagatctcaccgtgaaa
gtggccgacttcgggttagcgcggcaagtgtctaagcggatgagcttgaacgtggtcacc
gaaccgtacagagccccggagattttcgcagcacgctcggactacacgtgcgcgattgat
atgtggagcttaggggccgtgatcgcggacgctatggaaagcaaagtgacgttcttacct
cccccttccacgctacaaatgatcacggagctggccccggaccctggggaccttgtggga
gatgatattgtgacgcgcaacagagaaaagctgatgcccaaactcatgagatgcgagccg
gttaagagaatttcgcgcaatctggaggctccccgctctggagctgtttga

KEGG   Monopterus albus (swamp eel): 109952750
Entry
109952750         CDS       T05607                                 

Definition
(RefSeq) mitogen-activated protein kinase HOG1-like
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109952750
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109952750
   04114 Oocyte meiosis
    109952750
   04115 p53 signaling pathway
    109952750
   04218 Cellular senescence
    109952750
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109952750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109952750
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109952750
   03036 Chromosome and associated proteins [BR:malb03036]
    109952750
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109952750
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109952750
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109952750
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109952750
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo RIO1
Other DBs
NCBI-GeneID: 109952750
NCBI-ProteinID: XP_020443630
LinkDB
Position
Unknown
AA seq 333 aa
MENYLKQSIVGKGSYGTVYKVKCRRTGKEFALKYHTRDVTGVRAATGVEEDVIGVEEATV
RELSSLSALKGHPYVIQMLDCFVDSGTIAVLMPYVPYTLSKAIHNGHGMKFYYDQGQALQ
QQQGIPLSFVARFSIQVANALSYMHRLNFVHRDVTPFNVLLTEELTVKVADMGLARHSSR
WMSTTVVTEPYRAPELFVTDGCAQYTCAIDTWSLGVMIADAVEGKVVFSARKDHGTEVST
YQIIVRTLCPKDHPCASTVEPWDPDVVMPNAMKCKLVKRIILRLLAFHENERLLAHELLQ
DTEWTQAAHMTEEDTAMVRDQIRRRERELEARE
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggagaattatctgaagcagtccatcgtgggcaaaggctcctacggaacggtgtacaaa
gtcaagtgtcggcggaccggaaaggagttcgccttgaaatatcatacccgggatgtgacc
ggcgtaagggctgcaaccggcgtagaggaggatgtgatcggcgtagaagaagcgaccgtg
agagagctctccagtctctccgcgctaaagggtcacccttatgtgatccagatgcttgac
tgttttgtcgacagcggaacaatagccgtgctcatgccctacgtgccctacacgctgagt
aaagcgattcacaacggtcacggtatgaaattctactacgaccaaggccaggcgctacaa
cagcagcaggggatcccgttgagcttcgtggctcgtttttccatccaggtggctaacgcg
ctgtcgtacatgcacagactgaattttgtgcacagggacgtgacgcctttcaacgtgctg
ctgacagaagagctcaccgtcaaggtggctgacatgggcctcgcgagacactcctccagg
tggatgagcacaactgtagtgacggagccgtacagggccccggaattgtttgtcacagac
ggctgcgcgcagtacacttgtgccatagacacgtggagcctgggtgtgatgatagcggac
gccgtggaagggaaagttgtgttctcggcgcgcaaagatcacggtacagaggtgtccaca
taccagatcatcgtaaggactctatgtcccaaagaccacccctgcgcatcgaccgtcgaa
ccctgggaccctgatgtggtaatgcccaatgcgatgaagtgcaaactagtgaaaaggatc
atcctacgactgctggctttccatgagaatgagagacttctggctcacgagctgttgcag
gacacggaatggacgcaggctgctcatatgaccgaggaagacacggcgatggtcagagac
cagattcggcgacgagaacgggaactggaagcgagagaatga

KEGG   Monopterus albus (swamp eel): 109956212
Entry
109956212         CDS       T05607                                 

Gene name
cdk2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109956212 (cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109956212 (cdk2)
   04114 Oocyte meiosis
    109956212 (cdk2)
   04115 p53 signaling pathway
    109956212 (cdk2)
   04218 Cellular senescence
    109956212 (cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109956212 (cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109956212 (cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109956212 (cdk2)
   03036 Chromosome and associated proteins [BR:malb03036]
    109956212 (cdk2)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109956212 (cdk2)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109956212 (cdk2)
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109956212 (cdk2)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109956212 (cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kdo
Other DBs
NCBI-GeneID: 109956212
NCBI-ProteinID: XP_020448820
LinkDB
Position
Unknown
AA seq 298 aa
MDAFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVKLRDVIHTENKLYLVFEFLHQDLKKFMDSSSLTGIPLPLVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETVWPGVTSMPDYKPSF
PKWAKQDLSKVVPLLEEDGRELLGEMLAYDPNKRLSAKNALVHRFFRDVTMPLPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggatgcgtttcagaaggtggaaaagataggagaaggcacgtacggggtggtgtacaaa
gccaagaacaaagtgaccggagaaactgttgctctgaagaaaatcaggctagacacggaa
accgagggtgtaccaagcacggccatccgagagatttcacttctcaaagaactcagtcac
ccaaatattgtcaaactgcgagacgtcatccacaccgagaacaagctctaccttgttttt
gagttccttcatcaggatctaaagaagttcatggactcctcctcgctcactggtatcccc
ctgcctctggttaagagttatcttttccagttgctccaaggcctggccttctgccactct
caccgggtccttcatcgagacctgaagccacagaacctcctcatcaatgcccagggtgag
atcaagctcgctgactttgggctggcaagagccttcggggttcctgtccgtacatacaca
cacgaggtggtaacactttggtacagggcgccagaaattctcctgggctgcaaatactac
tccacagctgtcgacatctggagccttggatgcatctttgctgaaatgatcaccaggagg
gccttatttcccggcgactcagagattgatcagttattcagaatcttccgcaccttgggc
acccctgatgagaccgtctggccgggagtcacatcaatgcccgactacaaaccatctttc
cccaagtgggccaaacaggatttatccaaagtggtgcctcttcttgaagaggatgggaga
gaactgctcggagaaatgctggcgtatgatccaaacaaaagattatctgccaaaaacgca
cttgtacatcgattcttccgtgacgtcaccatgccacttcctcacctgagactctaa

DBGET integrated database retrieval system