KEGG   Monopterus albus (swamp eel): 109953012
Entry
109953012         CDS       T05607                                 

Gene name
sesn1
Definition
(RefSeq) sestrin-1 isoform X1
  KO
K10141  sestrin 1/3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109953012 (sesn1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 109953012
NCBI-ProteinID: XP_020444013
LinkDB
Position
Unknown
AA seq 547 aa
MEVQDREFLRRWDGLGSRDASSRTEAMENICQEVMRKVEAIGPLPASVPSPPASGSPSNS
ELNGILAHLLMLSQRCPFEDVRERCICLLQTVQDLGVRIPRPLGNGPSRFIPEQEILQVS
KVDTRTQSIFEDAFAALGRLDNVSLVMGFHPQYLDSFLRTQHYLLQMDGPLSLHYRHYIC
IMAAARHQCSYLVNLHVNDFLQVGGDPKWLNGLGEAPQKLQQLGELNKILAHRPWLLTKE
HMKCLLKAEEHSWSLAELIHAVVLLTHYHSLASFTFGCGIMAEIHCDGGHTFRPPSLSQY
CMCDIANGNGHSNHHDDPFGNQEVCGEVEVLMERMKQLQEGRDDEEASQEEMATRFEREK
TESMLVVTAEDEECVPSRDISRHFEDPTYGYQDFSRSGEHVPTLRVQDYSWEDHGFSLVN
RLYPDVGQMLDEKFQMAYNLTYNTMATHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEI
NQLLDRSFKIYIKTMVCSPEKTTKRMYESFWRQFQHSEKVHVNLLLMEARMQAELLYALR
AITRYMT
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggaagtgcaggaccgggagtttctgaggagatgggatgggctcggcagccgggatgcc
agctccagaaccgaagccatggagaacatctgccaggaggtcatgaggaaagtggaggct
attggacccttaccagcatcggtcccctcgcccccagcctctggaagcccctccaacagt
gagctgaatggtatcctggctcatctgctcatgttgtcccaacgatgtccatttgaagat
gtcagggagcgttgcatttgtcttctacagactgtccaggacttgggtgtaaggattcca
agaccattaggcaacggaccaagcagatttatccccgaacaagaaattcttcaagtcagt
aaagtggacaccaggacacaatcgatatttgaggatgcgtttgcagccctcggtcgcctc
gacaacgtctctctggtgatgggattccacccacagtacctggacagttttctccggaca
cagcactacctgctgcagatggatggacccttatctttgcactaccgacactatatctgc
atcatggcggcagctagacaccagtgctcctatttggtaaacctgcatgtgaacgacttc
ctccaagttgggggagatccaaagtggctgaacggcctgggtgaagcaccacagaagctg
cagcagcttggagagctcaacaagatccttgcccatcgaccatggcttctcaccaaggag
cacatgaagtgccttctgaaggcagaggaacacagctggtctcttgcagagttgatccat
gcagtggtcctcctcacacactaccactccctcgcctcattcacatttgggtgcggcatc
atggctgagatccactgtgatggcggacacacttttagacccccctccctcagccagtac
tgcatgtgtgacattgctaatggcaacggtcattctaatcatcatgatgatccatttggc
aaccaggaggtgtgtggtgaggtggaagtgctgatggagcgcatgaagcagctgcaggag
ggtcgtgatgacgaggaggccagccaggaggagatggcaacgcgctttgagagggagaaa
acagagagcatgttagtggtcacagcagaggatgaggagtgcgtcccctccagagacatc
tcccgccactttgaagaccccacctatggttaccaggacttttcacgtagcggggagcat
gtacccacactcagagtgcaggattacagctgggaggatcatggcttctctctggtcaat
cgactgtatcctgatgtcggtcagatgctggatgagaagttccagatggcctacaacctg
acctataacaccatggcaacacacaaggatgtggataccagtatgctgcgtagggccatc
tggaactacatccactgcatgtttggcatcaggtatgatgactatgattacggggagata
aaccagcttctggaccgtagctttaagatttatattaagaccatggtgtgtagtcctgag
aagaccaccaaacgaatgtatgagagtttctggaggcagtttcagcactctgagaaggtc
catgttaatctgcttcttatggaagcacgaatgcaagcagaactgttatacgctctgaga
gcgatcacccgctacatgacatga

KEGG   Monopterus albus (swamp eel): 109957995
Entry
109957995         CDS       T05607                                 

Definition
(RefSeq) sestrin-3-like isoform X1
  KO
K10141  sestrin 1/3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109957995
SSDB
Motif
Pfam: PA26 CMD Acetyltransf_14
Other DBs
NCBI-GeneID: 109957995
NCBI-ProteinID: XP_020451949
LinkDB
Position
Unknown
AA seq 438 aa
MIICTNKMEYPLRTQCQRVQKQVIVNGEKERVSLLFMKALVSRGSVDAVSQQMASHPQYL
ESFLRTQHYILHMDGPLPLPYRHYIAIMAAARHHCTYLVYLHSTNFLRVGGDPMWLQGLE
AVPPRLRLLDHINKVLAHQPWLTAWPHIQTLLKSGEQCWSLAELVQAVVILAHCHSLCSF
VFGCDADSDSKSPNGTPPTFCPFDAANGNANVPQSLATPPEHITRRRQFLWRLCQQSLDS
SCDMACLKQRIQKSQDECLLQQADAEEEDEMICFADPSRFITDPDFCYQEFARREEDHFQ
VFRVQDYSWEDHGFSLVNRLYSDIGHLLDDRFRSVTTLPSLHSPDLKRAIWNYIHCVLGI
RYDDYDYGEVNQLLERDLKLYIKAVACFPDATKTPVCPLSWAILKTSERIHVNLLIMEAR
LQAELLYALRAITQYMIT
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgatcatctgtacgaataaaatggagtaccccctgagaacgcagtgccagcgagtccag
aaacaggtgatagtgaacggtgagaaggagcgagtgtcgctgttgttcatgaaggctctg
gtcagcagggggagcgtggatgctgtgtcccagcagatggcctctcatcctcagtacttg
gagagcttcttgcgcacacagcactacatcctgcacatggacggcccccttccgctgcca
taccgccattacatcgccatcatggctgcagcacgacatcattgtacctacctggtgtac
ctgcactcaaccaactttctaagggtgggtggggaccctatgtggttacagggcttggag
gcagtgccccctcgccttcgcctccttgaccatatcaacaaagtgctggctcaccaaccg
tggctcactgcctggccacacatccagacgctgctgaagtcgggcgagcagtgctggtcg
ctggctgaactggtgcaggccgtggtgatcttggctcactgccactccctctgcagcttt
gtgtttggatgcgacgcagactcagactccaaatctcctaacggaaccccaccaaccttc
tgcccctttgatgctgccaacggcaatgccaacgtgcctcagtcacttgccactccccct
gaacacataacacgacgacggcagtttttgtggcgcctgtgtcaacagtctctggactcc
agttgtgacatggcgtgtctaaagcagaggatccagaagtcccaggacgagtgtcttctg
cagcaagcagatgcagaagaagaggacgagatgatatgctttgcagacccgtcacggttc
atcacagaccctgacttttgttatcaggagtttgctcggagggaggaggatcacttccaa
gtatttagagttcaggactattcatgggaggaccacggcttctccttagtcaacagattg
tattcagacattgggcacctcttggacgaccgattcaggagtgtgaccaccctcccctct
ttgcacagccctgacctgaagagggccatctggaattacatccactgtgttttaggaata
cgatatgacgattatgactatggagaggtgaaccagttgctggagcgggatttgaagctg
tacatcaaggctgtggcttgttttccggatgccaccaaaactccagtgtgtccactgagc
tgggctatacttaaaacatccgaacggatacatgtgaatttattaatcatggaggcccgg
ctgcaggcggagctactatatgctctgagagccatcactcagtacatgattacctaa

KEGG   Monopterus albus (swamp eel): 109963978
Entry
109963978         CDS       T05607                                 

Definition
(RefSeq) sestrin-2-like isoform X1
  KO
K20394  sestrin 2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    109963978
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109963978
SSDB
Motif
Pfam: PA26 CMD MPP6 TetR_C_6
Other DBs
NCBI-GeneID: 109963978
NCBI-ProteinID: XP_020462607
LinkDB
Position
Unknown
AA seq 565 aa
MRKMASHCESDVTCQANGENTPGRVSGSGSRHRSESETDVGPTVKSLARLCSRDEEERAA
ALEELSQGVLVCLGLNQPGKARLSKQTLLHLLRLSQSCPLQEVQERATELLRTAQEQGVE
VPRALTSGPSAFIPSKEMLKEGPDQDILIESFLSLGRVDHITMVMALHHAYLSCFLRTQH
ALFELDGPLPHHWRHYIAIMAAARHQCSYLVQQHSAGFLEAGGEESWLSGLEHAPTKLRS
LQTLNKLLAHRPWLIAQQHIQELVCPGAEPRWSLAELIHAVILMAHAHSLCSFVWGCGIK
PEPDHIGGYTFAPHSPSRLSHSPHSPAHEDGRQELADGVMEVEVLMKRMVELQQQQLQQQ
EEEEEECTQEEMVTRFERERSESIPTAVVRGAPPELVLRLVEDPGFRYEDFAPRGEQAPP
TMRAQDYSWEDHGFSLVNRLLPDMGQLLDEKFQVVSDLTYHRMAMHEGVDTYTLRKALWN
YIHCLYGIRYDDYDYGSVNVLLERSLKVFVKTVACHPEQTTARVYCSFWRHFRHSEKVHA
NLIVMEARLQAALLYPLRAITHYMR
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcgaaagatggccagtcactgcgagtcagacgttacctgtcaggctaatggagaaaac
acacctgggcgagtgtccggctcaggctctcgccaccggtccgagtccgagaccgacgtg
gggccgactgtgaaaagcttagctcggctgtgcagcagggacgaagaggaaagggcagcg
gctttggaggagctgagtcagggggttctggtgtgcttaggactgaaccaacccggtaag
gcacggctgagtaaacaaactcttttgcatctgcttcggctgtcccagtcttgcccgctg
caggaggtacaggagcgagcaaccgagctgctgcgaaccgcacaggaacaaggagttgaa
gtgcctcgggctctgacctcaggtccaagtgcttttatcccttctaaagagatgttaaaa
gaagggccggaccaggacatcctgattgaatcttttctttcactgggtcgtgtggaccac
atcaccatggtaatggcactgcaccatgcgtacctcagctgcttcctgaggacccagcat
gctcttttcgagctggatggtcccctgccccatcactggagacattacattgccatcatg
gctgcagctcgacaccagtgctcgtacctggtacagcagcacagtgcgggcttcctggag
gctggaggggaggagagctggctgagtggcctggagcacgctcccaccaaactccgcagc
ctgcaaacactcaacaagctgctggcacacagaccctggctcattgcacagcagcacatc
caggagctggtttgtcctggcgcagagcctcgctggtcattagctgaacttatacatgct
gtgatcctgatggcacatgctcattcactctgctcttttgtgtggggctgcggcataaaa
cctgaacctgaccacattggaggttacaccttcgcacctcattcacctagtcgcctttct
catagcccccatagccccgctcatgaagatggcaggcaagagttggctgatggagtgatg
gaggtggaggtgctgatgaagaggatggtggagctgcaacaacagcagctgcaacaacag
gaggaggaggaggaggagtgcacacaggaggagatggtgactcgctttgagagagagagg
agtgagagcataccaacagcggtggtgaggggagctccacctgagctagtgttgcgcctg
gtggaggatccagggtttagatatgaggactttgcaccgagaggagagcaggcaccaccg
accatgagagcacaggactattcatgggaggaccatggcttctctctggtcaacagacta
ctgccagacatgggccagctcctggatgagaaattccaggttgtgagtgacttgacctac
cacagaatggccatgcatgaaggtgtggacacttacactctgagaaaagctctgtggaac
tacatccactgcctctatgggatacgatatgatgattatgattacggcagcgtgaacgtg
ttgttggagcgctctctgaaggtgtttgttaaaaccgtggcctgtcaccccgagcagacc
acagcacgcgtctactgctccttctggaggcacttcagacactctgaaaaggttcatgca
aacctaatagtgatggaagcccgtctacaggcagcccttctttaccccttacgagccatc
acacattacatgagatga

DBGET integrated database retrieval system