KEGG   Monopterus albus (swamp eel): 109953039
Entry
109953039         CDS       T05607                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109953039
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109953039
SSDB
Motif
Pfam: Cyclin_N DUF902 MazG_C
Other DBs
NCBI-GeneID: 109953039
NCBI-ProteinID: XP_020444047
LinkDB
Position
Unknown
AA seq 330 aa
MRDLQVIDSLLLKELKLCCAKEYSFLPKEAGLKLMEMASTENPSGLSAKCRDARVEELWG
LTSFFGYSTQTFVQAVNMLDRFLTIMKVQPKHLPCIGVGCLHIAAKMVEEESNVPPTHEL
IRISQSRFTVSDLCRMEKIISEKLSVEPEAVTALTFLHLYYSAFTSLSAGREEIPSIGRL
EAQLKACLCRLVFSKAKPSVLALSLIAQEFEALQSITVLKIVQQFQRHLKISNTELFHWK
ELVAKCMTEYRSSECNKPDNKKLVWIVSRRTAQNLQANHVSVPGLPTIPEGNWDESESED
MSCGEDSPCGSPGSDGEGAFFPSAFLRCRK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcgggatcttcaagtcattgacagcttgctcttgaaagagttgaagttatgttgtgcg
aaagagtacagttttcttcccaaagaggccggactgaagctgatggagatggcttccaca
gaaaatcccagtggattgtcggcaaaatgcagggacgccagagtggaggaactgtggggc
ctgaccagcttctttggctacagcacccaaacttttgttcaagcggtcaatatgctcgac
agattcctcaccatcatgaaggtgcagcccaaacacttgccttgtatcggagtgggctgt
cttcacatcgcagccaaaatggttgaggaagagagcaatgtcccccccacccatgagctc
attagaatcagccaaagcaggttcactgtgtcagacctctgccgcatggagaagatcatc
tcagagaagcttagcgtggagcccgaggcagtgacagccttaacctttctgcacctctac
tactcagccttcacatctctgtctgcgggaagggaggagatcccaagcattgggagactg
gaagcccagctaaaagcgtgcttatgtcgacttgttttctctaaagcaaaaccatcagtg
ctggcgctgtccctcattgctcaagagtttgaagccctccagtccatcaccgtgctgaag
attgtccagcaattccaaagacatctgaagattagcaacaccgagcttttccactggaag
gaacttgtggccaaatgcatgacagagtaccgctcaagtgaatgtaacaaaccagacaac
aaaaagcttgtttggatcgtgtccaggagaacggcacagaatcttcaggccaatcatgtc
agtgtacctggtctaccaactattcctgaggggaactgggatgagagtgaaagtgaggac
atgagctgtggagaggacagtccgtgtggctcgccaggcagtgatggtgaaggagcattt
ttcccctccgcctttctcaggtgtagaaagtga

KEGG   Monopterus albus (swamp eel): 109960783
Entry
109960783         CDS       T05607                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109960783
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109960783
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 109960783
NCBI-ProteinID: XP_020456794
LinkDB
Position
Unknown
AA seq 334 aa
MDAFKLMKELRVNHEHEVYYLPKETGLMLIESTTRDDNRISAKCRNAKVEDLWSLTSFFG
YSTQTFVLAVNLLDRFLAMMRIQPKHLSCVSLSCLHMAAKVTEEECNLTPTDELIRIGQC
RFTVADLGRMEKIVAEKLNFNSKAITALTFLHLYHQILLSHSTDRKETLNLEKLEAQLKA
CLCRISFSKAKPSILALSLLRQEIEAIQSEDMLEIACHIQRHLKIADGELLLWRERVAQC
LSDYASPECSKPNHRKLQWIVSRRTAQNLHSYRIVPELPTIPEGCWDESESEDSCEDVMS
SGEESLSSSLGSDAEGPFFPLHIRRQKHCQHLLT
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggacgccttcaagctgatgaaggagctgcgggtgaatcatgagcatgaggtttattat
ctccctaaagagacgggactgatgctcatagaatccacaacacgggacgataatcggatc
tcagccaagtgcagaaatgccaaagtggaggacctgtggagtctgaccagcttcttcggt
tacagcacacagaccttcgtcctggctgttaacctgctggacagattcctggccatgatg
aggatccagccaaagcacctgtcctgtgtcagcctcagctgcctccacatggcggccaaa
gtaacagaggaggagtgtaacctgacgcccaccgacgagctcatccgcataggacagtgc
aggttcactgtggccgacctgggcaggatggagaagattgtcgcagagaagctcaacttt
aactctaaagccatcactgccttaacctttctgcacttgtaccaccagattttactttcc
cattccacagacaggaaggagactcttaacctggagaaactggaggctcagctcaaggcc
tgtctgtgccggatctccttctccaaagcaaagccgtccatcctagccttgtctctcctg
aggcaagagatcgaagccattcagtcggaggacatgttggaaatcgcgtgtcacatccag
agacacctaaagattgcagatggtgagctgctgctgtggagggaacgtgtggctcagtgt
ctgtcagactatgcctctcctgaatgcagcaaacccaaccacaggaagctgcagtggata
gtgtcgcggaggactgcccagaacctgcacagctatcgcattgtccctgagctacccacc
atccccgagggctgctgggatgagagcgaaagtgaggattcctgtgaggatgtgatgagt
tcaggtgaggagtccctcagcagttctctgggcagcgatgctgaagggcccttcttccct
ctgcacatccgccgccaaaaacactgccagcaccttctcacctga

KEGG   Monopterus albus (swamp eel): 109971158
Entry
109971158         CDS       T05607                                 

Gene name
ccng1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109971158 (ccng1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Ada3
Other DBs
NCBI-GeneID: 109971158
NCBI-ProteinID: XP_020474900
LinkDB
Position
Unknown
AA seq 299 aa
MIETVTGPGAKPFAVELKGMTDLEARYQPLLSGLRLIEGAQDNGLRMTPRLRELEVKDLL
SLTRFFGFSSETFSLAISMLDRFLSVVKIQPKHLACVGLCCFYIAVKSSEEEKNVPLAND
LIRISQNRFTVSDMMRMEKIILEKLYWKVKAPTALHFLRFFHNHIQEQLDAESKKILSLE
RLGAQLKACHCSFAFSKIKPSLLAIALLCYEAQEQHDPKHADKISEALRSLQQQLNIKDG
DLLCVHELVGKCLTEYTNTKCAKPNSHRLRWTISGRTARQLKHSYYKIAHLPTIPESAS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgattgaaacagtcacaggacccggagcaaagccctttgctgttgaactgaagggcatg
acagatctggaggcacgataccaaccactgctgagtggtttgaggctcatagagggtgcc
caggacaatggcctcaggatgacccccagactgagggagttggaggtgaaggacctgctc
tctctgaccaggttctttggtttcagctcagagaccttctcactggccatcagcatgcta
gatcgattcctttctgtagtaaagattcaaccaaagcacctggcctgtgtgggcctctgc
tgcttctacattgctgtgaagtcctcggaagaggagaagaacgtgcctctggccaatgac
ctgatccgcatcagtcagaatcgcttcacagtgtctgacatgatgagaatggaaaagatc
atcttggagaagctctactggaaggtgaaggcccccacagccctccactttctccgcttc
tttcacaaccacatccaggagcagctcgacgctgagagcaagaagatactgagccttgag
agacttggggctcagctgaaagcctgtcactgctcatttgcattctccaaaataaagcca
tctctgcttgccattgctctcctgtgttatgaggctcaggaacaacacgacccaaagcac
gctgacaaaatatcagaggccctgcgaagtctgcagcagcagctgaatatcaaagatgga
gatcttctgtgtgtgcatgagttagttggaaaatgcctgactgaatataccaacaccaag
tgcgcaaagccaaacagccatagacttcgctggaccatttcaggaagaacggcacgtcag
ctgaagcacagctactataagatcgctcatcttcccaccatacccgagtctgcttcttaa

DBGET integrated database retrieval system