KEGG   Monopterus albus (swamp eel): 109953831
Entry
109953831         CDS       T05607                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2-like
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00230  Purine metabolism
malb00240  Pyrimidine metabolism
malb00480  Glutathione metabolism
malb00983  Drug metabolism - other enzymes
malb01100  Metabolic pathways
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109953831
   00240 Pyrimidine metabolism
    109953831
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109953831
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109953831
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109953831
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:malb03400]
    109953831
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109953831
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109953831
SSDB
Motif
Pfam: Ribonuc_red_sm Alpha-amylase_N
Other DBs
NCBI-GeneID: 109953831
NCBI-ProteinID: XP_020444940
LinkDB
Position
Unknown
AA seq 217 aa
MFLFVCFQPKSVKKSSSMEDEPLLRGDPHRITIFPIQYNDIWDMFKTAEASFWTIEEVDL
SNDLENWESLNDEERHFISHLLASFVTMNRIVEKNLVRHFTKEVRALEARRFYIFQLTRG
NIHFQMYSLLINTYIREPENIEHLFNPIETLPYVRKKADWANNWIDNDSANYGERVVAFA
AVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDE
NT seq 651 nt   +upstreamnt  +downstreamnt
atgttcttgtttgtatgttttcagcccaaatccgtgaagaagagcagcagcatggaggac
gagccactgctgaggggcgacccacatcgcatcaccattttccccatccagtacaacgac
atctgggatatgttcaagacggccgaggcgtctttctggaccatagaggaggtggacctg
tccaatgacctggagaactgggagtctctaaatgacgaggagcgccacttcatctctcac
ctgttggcgtcttttgtcaccatgaacaggatcgtcgaaaagaacctggttaggcacttc
acaaaggaagtacgggcattggaggccaggcgtttctacattttccagctcaccagaggg
aacatccactttcagatgtacagcctcctcatcaacacctacatcagggagcccgagaac
atagaacacctgttcaatcccatcgagacgttgccatacgtgaggaagaaggctgactgg
gcgaacaactggatcgacaacgacagcgccaactatggggagcgtgtggtggcgttcgcg
gccgtggagggaatcttcttctctgggtccttcgctgcgatcttctggctgaagaagaga
ggcctgatgcccggcctgaccttctccaacgagctcatcagcagagacgag

KEGG   Monopterus albus (swamp eel): 109958595
Entry
109958595         CDS       T05607                                 

Gene name
rrm2b
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00230  Purine metabolism
malb00240  Pyrimidine metabolism
malb00480  Glutathione metabolism
malb00983  Drug metabolism - other enzymes
malb01100  Metabolic pathways
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109958595 (rrm2b)
   00240 Pyrimidine metabolism
    109958595 (rrm2b)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109958595 (rrm2b)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109958595 (rrm2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109958595 (rrm2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:malb03400]
    109958595 (rrm2b)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109958595 (rrm2b)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109958595 (rrm2b)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 109958595
NCBI-ProteinID: XP_020452999
LinkDB
Position
Unknown
AA seq 366 aa
MTPTVKKKTSLEMDVTDINHHSNHLKESNGFKDKDPDCQNGSETEDEPLLQENPRRFVMF
PIQYPDIWKMYKQAQASFWTVEEVDLSKDLEHWDRLKPEEKHFISYVLAFFAASDGIVNE
NLVQRFSQEVQVPEARSFYSFQMLIETVHSEMYSMLINTYIRDLKERDYLFNAIQTMPCV
KQKADWALQWINDNKSTFGERIVAFAAVEGIFFSGSFAAIYWLKKRGLMPGLTYSNELIS
RDEGLHCNFACLLYSYLLKKPSEDRVKDIIAKAVSIEQEFLTEALSVDLIGINSCLMKQY
IEFVADRLLTDLGLAKVYQAENPFDFMESISLEGKTNFFEKRVAEYQRFGVMSSMMDCEF
TLDADF
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgacgccgacggtgaagaagaagacttctctggaaatggatgtgacggatataaatcat
cactctaatcatcttaaagaatcgaatggttttaaagataaagatccagactgccaaaat
ggttcagaaacagaggacgagcctttgctgcaggaaaaccccaggcggttcgtcatgttc
cccatccagtatccggacatctggaagatgtacaagcaggcacaagcctctttctggacg
gtggaggaagttgacctatccaaagacctggaacactgggaccgtttgaagcctgaggag
aaacatttcatctcctatgtgcttgctttctttgctgccagtgatggtatcgtcaatgag
aacctggtacagaggttcagccaggaggtgcaggttcctgaagcacggtccttctatagc
ttccagatgctcatagaaactgttcactctgagatgtacagcatgctcatcaacacttat
attagggacctgaaggagagggactatttgtttaacgccattcagaccatgccgtgtgtg
aaacaaaaagcagactgggccctccaatggataaatgacaataaatccacatttggggag
cgaattgtggcttttgcagctgtggaaggcatcttcttctctggctcatttgctgctatc
tattggctcaaaaagaggggcctaatgcccggtcttacctactccaacgagctgatcagc
agggatgagggcctgcactgtaactttgcctgcctgttatacagctacctgctgaaaaag
ccatcagaggacagagtgaaggatatcatcgccaaagcggttagcattgaacaggagttt
ttgactgaggccttgtcagtggatcttattggaatcaacagctgtctgatgaaacagtac
atcgagtttgtggccgaccggcttctcactgacctcgggctggctaaggtttaccaagct
gagaatccttttgacttcatggagtccatttcactggaggggaaaaccaacttctttgag
aaacgagtagcagagtatcagagatttggagtcatgtcaagcatgatggactgtgaattc
actcttgatgctgacttctga

KEGG   Monopterus albus (swamp eel): 109974456
Entry
109974456         CDS       T05607                                 

Gene name
rrm2
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00230  Purine metabolism
malb00240  Pyrimidine metabolism
malb00480  Glutathione metabolism
malb00983  Drug metabolism - other enzymes
malb01100  Metabolic pathways
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109974456 (rrm2)
   00240 Pyrimidine metabolism
    109974456 (rrm2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109974456 (rrm2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109974456 (rrm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109974456 (rrm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:malb03400]
    109974456 (rrm2)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109974456 (rrm2)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109974456 (rrm2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 109974456
NCBI-ProteinID: XP_020480311
LinkDB
Position
Unknown
AA seq 389 aa
MHSARSPRSPLCLKIEQSLSSRISNMALDKENTPPSLNNTRILASKTARKIFDDASPKSV
KKSSSSKEVEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSMDQQHWESLR
DEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLI
NTYIKEPKEREYLFNAIETLPCVRKKADWALNWIGNRSATYGERVVAFAAVEGIFFSGSF
AAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPPKETVTAIIRNAVEIE
QEFLTDALPVKLIGMNCEMMKQYIEFVADRLILELGFNKIYQVENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMSGSTDKTFRVDADF
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcattctgctcgttctcctcgatctcctttgtgcctgaagattgaacagtctctcagc
agccggatcagcaacatggcactggacaaagaaaacacgcctccgagcctgaacaacacc
cgcatactggcctcgaaaaccgcgcggaaaatcttcgacgacgcttcgcccaaatccgtg
aagaagagcagcagcagcaaggaggtggagccgctgctgaaggacaaccctcatcgcttt
gtcatcttccccatccagtaccacgacatctggcagatgtacaagaaagccgaggcgtct
ttctggaccgcagaggaggtggacctgtccatggaccagcagcactgggagtctctaagg
gacgaggagcgctacttcatctctcacgtgttggcgttctttgccgccagcgacgggatc
gtcaacgagaacctggtggagcgcttcacacaggaagtgcaggtgacggaggccaggtgt
ttctatggtttccagatcgccatggagaacatccactctgagatgtacagcctcctcatc
aacacctacatcaaggagcccaaggagagagaatacctgttcaatgccattgagacgttg
ccatgcgtgaggaagaaggctgactgggcgctcaactggatcggcaacaggagcgccacc
tacggagagcgtgtggtggcgttcgcggccgtggagggaatcttcttctctgggtccttc
gctgcgatcttctggctgaagaagagaggcctgatgcccggcctgaccttctccaacgag
ctcatcagcagagacgaggggctgcactgtgactttgcctgtctgatgttcaagcacctg
gtgaacaagccgcccaaagaaaccgtcaccgccatcatcaggaacgccgtggagattgaa
caggagttcctgacggatgctctgccggtgaagctgatcgggatgaactgcgagatgatg
aagcagtacatcgagtttgtggccgacagactgatcctggagctcggcttcaacaagatc
taccaggtggagaaccccttcgacttcatggagaacatctctctggagggaaagaccaac
ttctttgagaagcgtgtgggcgagtaccagaggatgggcgtgatgtctggctccacggac
aaaaccttcagagtggatgctgacttctga

DBGET integrated database retrieval system