KEGG   Monopterus albus (swamp eel): 109954756
Entry
109954756         CDS       T05607                                 

Gene name
rchy1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109954756 (rchy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109954756 (rchy1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:malb04121]
    109954756 (rchy1)
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109954756 (rchy1)
Ubiquitin system [BR:malb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109954756 (rchy1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 Prok-RING_4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 109954756
NCBI-ProteinID: XP_020445946
LinkDB
Position
Unknown
AA seq 278 aa
MASHSGCQHYVRSCLLKAPCCGKLYVCRLCHDAEENHQMDRFKVREVQCSECQTVQQAQQ
TCQQCHVLFGEYYCDICHLFDKDKKQYHCQPCGICRIGPRESYFHCEKCNLCLAQDLHGN
HKCVENVSRQNCPVCMEDIHTSRIGACVLPCGHLLHKTCFDDMVRRGVYRCPLCMHSARN
MEDEWDQMDIEITESPMPTEYQGATVKIICNDCQAHCMVPFHVLGLKCSSCGSYNTAQEG
GLIQQLQQWPEQDADTDSEAETNMEPELQDQTESSTPH
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcgtcccattccggttgtcagcattatgtacgaagctgtttactaaaggcaccttgc
tgtggtaaactgtatgtgtgtcggctgtgccatgatgcagaggagaaccaccagatggat
cgcttcaaagtcagagaggtgcagtgctctgaatgtcaaacagtgcaacaggcacagcag
acttgccagcagtgtcatgtgctgtttggggagtattactgtgacatttgccacttgttt
gacaaggataagaagcagtaccactgtcagccctgtggaatatgcaggattgggcccagg
gaaagctatttccattgtgagaagtgcaatctgtgtttagcacaggatctgcatggaaac
cacaagtgtgttgaaaatgtgtcaaggcagaactgcccagtgtgtatggaggatattcac
acatccagaatcggagcctgcgttcttccatgcggccatcttttacacaagacctgcttt
gatgacatggtcagaagaggagtgtatcgctgccctctgtgtatgcactctgctcgcaac
atggaggacgaatgggatcagatggacatagagatcactgagtcaccaatgcccactgaa
taccagggtgctactgttaaaattatatgtaatgactgccaagcccactgcatggtgcct
ttccacgtgttgggtttgaagtgcagcagttgtggttcctacaacacggcacaggaagga
ggactcatccagcagcttcagcagtggccagagcaggacgctgacactgacagtgaggca
gaaacaaacatggagccagagctgcaagatcaaaccgagtcatccacaccacattag

DBGET integrated database retrieval system