KEGG   Monopterus albus (swamp eel): 109955077
Entry
109955077         CDS       T05607                                 

Gene name
tgfb3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109955077 (tgfb3)
   04350 TGF-beta signaling pathway
    109955077 (tgfb3)
   04068 FoxO signaling pathway
    109955077 (tgfb3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109955077 (tgfb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109955077 (tgfb3)
   04218 Cellular senescence
    109955077 (tgfb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109955077 (tgfb3)
Cytokines and growth factors [BR:malb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109955077 (tgfb3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109955077
NCBI-ProteinID: XP_020446541
LinkDB
Position
Unknown
AA seq 405 aa
MNLGKALLFFLLSNCVTMSLSLSTCTTVDIDHIKKKRVEAVRGQILSKLRLTSPPQTTGP
SQVPLHVLALYNSTKELIEELGRDRQQSCGQDNTETEYYAKEIYKFNMISGSPENNDLLY
CPKGITSKVFRFNVSVMEKNSTNLFRAEFRALRTPNSSAKKNEQRIELYQILQKDDPKAK
QRYIGGKNVLTKGTPEWVSFDVTETVREWLMYRQTNLGLEISVHCPCHTFRPNGDIIENA
NEVLEVTFKGMEVDYDDRSRGKKQKEQLYPHLILMMLPPHRLDAQSSSRRRKRALDTNYC
FNNYEENCCVRPLYINFRQDLGWRWIHQPEGYYANFCSGPCPYLRSADTTHSSLLSLYNT
LNPEASASPCCVPQDLEPLTILYYVGRSPKVEQLSNMVVKSCKCS
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgaatctgggcaaagcacttctgtttttcctcctctcaaactgtgtgacaatgagtttg
tcgctatccacttgcaccactgtggacatcgaccacataaagaagaagagagtagaggcg
gtccgcggacagatcctcagtaaacttcggctgaccagtccacctcaaacaacaggtcca
agtcaagtgccgcttcacgtcctggctctttataacagcaccaaggaactcatcgaggag
ctgggaagagacaggcagcagagttgtggacaggataacacggagactgagtactatgcc
aaagagatttacaaattcaacatgatcagtggttcgccagaaaacaatgaccttctttac
tgcccgaagggtatcacctccaaggtatttcgcttcaacgtctcagtcatggagaagaac
tccaccaacttgttccgggccgagtttcgagccctgcggacgccaaattccagcgccaag
aaaaacgaacagaggattgagctctaccagattctccagaaagatgaccccaaagccaag
cagcgctacattgggggcaaaaatgtcctgaccaaaggaacacctgagtgggtctccttt
gatgtgacagagacagtgagagagtggctgatgtaccgacagaccaatcttggcctggag
atcagcgtgcactgtccctgccacactttcagacctaatggcgacattatcgagaatgcc
aatgaggtgctagaggtcacgttcaaaggtatggaagtggactatgatgatcggagccgt
gggaaaaaacagaaggagcagctctacccccacctcatcctcatgatgctccctccccac
aggctggatgcccagtcctcttcccgcaggcgcaagcgggcacttgacaccaattactgc
ttcaacaattatgaggagaactgctgtgtgcgaccactatatattaatttccgccaggat
ttgggctggagatggatccatcaacctgaagggtactatgctaacttctgctctggtccc
tgtccttacctacgcagtgcagacaccacccacagctcgctgctgagcctctacaacacc
ttgaaccccgaagcatccgcctcaccctgctgtgttcctcaggacttggagcccctcacc
atcctctactacgtgggtcgctccccgaaagtcgagcagctctctaatatggttgtcaag
tcctgcaagtgcagctaa

KEGG   Monopterus albus (swamp eel): 109956839
Entry
109956839         CDS       T05607                                 

Definition
(RefSeq) transforming growth factor beta-2-like isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109956839
   04350 TGF-beta signaling pathway
    109956839
   04068 FoxO signaling pathway
    109956839
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109956839
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109956839
   04218 Cellular senescence
    109956839
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109956839
   00536 Glycosaminoglycan binding proteins [BR:malb00536]
    109956839
Cytokines and growth factors [BR:malb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109956839
Glycosaminoglycan binding proteins [BR:malb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109956839
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109956839
NCBI-ProteinID: XP_020449879
LinkDB
Position
Unknown
AA seq 416 aa
MWLPRFALLLLLRFPGVLLVEGLNTCQAINLDTQKSRRIEAVRGQILSKLRIRSPPDDDE
APPPVPVPPEVMLLYNSTRELLKERARLSESACERESSEEDYYAKEVQRIDMLPPRPDTN
TLQPAAPDPHYRVIHFDVSGVDLTNSTLVKAEFRIFRAPNPQAQASEQRVEIYQLLKPDE
ESASTQRYIDSRTVQPKAKGAWVSVDVTETVKDWVSDPENNLGLKLGVHCPCCTFVPSTN
NIVANKSEELEALFAGVDNELLHQIRKPGQVKDFSTKTPHLILTLLPSDRVDNPAKKNRK
KRAAATDATTCSRSSDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYLWSANN
HYNMILPLYNKLNPEASASPCCVPQDLEPLTIMYFIGRTPRVEQLSNMVVKSCKCR
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtggctcccccgcttcgcgctgctgctgctgctccggtttcccggtgtgttgctggtg
gaggggctcaacacgtgccaggccatcaacctggacacgcagaagtcccggcgcatcgag
gcggtccgaggccagatcctcagcaagctccgcatccgcagcccgccggatgatgacgag
gccccgccgcctgtcccggtgcccccggaggtcatgctgctttacaacagcacgcgggag
ctgctgaaggagcgtgcgcgtctgtcggagtcggcgtgcgagcgcgagagcagtgaggag
gactattacgccaaagaggtgcagaggattgacatgctgcccccccgccccgacacaaat
acgctgcagccagcagcgcctgacccccactacagagtcatccattttgacgtcagtgga
gttgacctgaccaacagcaccctggtcaaagctgagttcaggatcttcagagctcccaac
ccacaggcccaggcttcagagcagagagtggagatctatcagctgctgaagcctgatgaa
gagagcgcctccactcaacgttatattgactcccgcaccgttcagccaaaggcgaaggga
gcctgggtctccgtggatgtcaccgaaaccgttaaggactgggtgtcagatccagagaat
aaccttggtctgaagctgggcgtccactgtccctgctgcaccttcgtcccatccacaaac
aacatagttgccaacaagagtgaggagctggaggccctgtttgctggtgtagataacgag
ctgcttcatcagataagaaagcctggtcaggttaaagatttcagcaccaagacgccgcac
ctcatcctcaccctgctgcccagcgacagagtggacaatccggccaagaagaaccgcaag
aagagggcagctgccactgacgccaccacctgctcccgcagctcagaccagggctgctgc
ctgcgctcgctttacatcgacttcaggcgtgacctcaactggaagtggatccacgagccc
aaaggctacaaagccaacttctgtgctggaaactgtccttacctctggagtgccaacaac
cactataacatgatcctgcccctgtacaacaagctgaaccctgaggcctccgcttcaccc
tgctgtgttcctcaggacctggagcccctcaccatcatgtacttcataggtcgcacaccg
cgtgttgagcaactctccaacatggtggtcaaatcctgcaaatgccgctga

KEGG   Monopterus albus (swamp eel): 109963227
Entry
109963227         CDS       T05607                                 

Definition
(RefSeq) transforming growth factor beta-1-like
  KO
K13375  transforming growth factor beta-1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
malb04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109963227
   04350 TGF-beta signaling pathway
    109963227
   04068 FoxO signaling pathway
    109963227
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109963227
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109963227
   04218 Cellular senescence
    109963227
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    109963227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:malb03110]
    109963227
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109963227
   00536 Glycosaminoglycan binding proteins [BR:malb00536]
    109963227
Chaperones and folding catalysts [BR:malb03110]
 Intramolecular chaperones
  Others
   109963227
Cytokines and growth factors [BR:malb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109963227
Glycosaminoglycan binding proteins [BR:malb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109963227
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109963227
NCBI-ProteinID: XP_020461231
LinkDB
Position
Unknown
AA seq 385 aa
MKLALLMLMVVYTMGNVSGMSTCKTLDLEMVKKKRIEAIRSQILSKLRLPKEPKESDQSE
VQQAIPSSLLSLYNSTIEILKEKEAKDPTSISTDQEEMDYFSKVAHKFNMTKPTKNSKNI
TMSFNMTEIRGSVGDYLLLTSAELRMLIKRTSMPTEQRVELYHGLGPSTHYLTTRFIGNS
FKDNWLTFDVTKILQDWLKETDKEQGFQLRLFCECNSGQQTSAESAFNFQISGISGDRGD
TASMAQTTQQPPYILTMSIPKNISSHLTSRKKRSTDSRDTCTAQTENCCVRSLYIDFRRD
LGWKWIHKPTGYHANYCMGSCTYVWNAENKYSEILALYMHHNPGASAQPCCVPDVLEPLP
ILYYLGRQHKVEQLSNMIVKSCKCS
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaagctggcgttgttgatgctcatggttgtgtacacaatgggcaacgtaagtggtatg
tctacatgtaagacgctggacctggagatggtgaagaaaaagcgcatcgaggccattagg
agccagatcctcagcaaattgcgtctgccaaaagagccaaaagagtcagatcagtctgaa
gtccagcaagcaatccctagctccctgctgtctctctacaacagcaccatagagatactg
aaggaaaaggaggccaaggacccaacaagcatctctacagatcaggaggagatggactac
ttctccaaggtggcacacaagttcaacatgaccaagcccaccaaaaactcaaaaaacatc
acgatgtccttcaacatgactgagatacggggaagtgtgggggactacctactgctgacc
agtgcagagctgcggatgctcatcaagagaacttcaatgcctactgagcagcgggtggag
ctgtatcatggtctggggccctcaacccactacctcactacccgcttcatcggtaactcc
tttaaagacaactggctgaccttcgatgtcaccaagatcctgcaggactggctcaaagag
actgacaaggagcagggtttccaacttcggctgttttgtgaatgcaacagtggccagcag
acaagtgctgagagtgccttcaattttcaaatctctgggatttcgggcgataggggagac
acagcatcgatggcacagacgacacagcaaccaccctacatcctgaccatgtccatccct
aaaaatatcagtagtcacctcacctcacgcaaaaaacgctccacagactcaagggataca
tgtaccgcccagacagaaaactgctgtgtgcggagcttgtatattgacttcaggagagat
ctgggctggaagtggattcacaagccaacgggctaccatgccaactactgcatgggttcc
tgcacctatgtctggaatgctgaaaacaaatattctgagattttggccctgtatatgcat
cacaacccaggagcctctgcccagccctgctgtgttcctgatgtactggagccactgcca
atcctctactacttgggcaggcaacacaaggtggagcagctgtccaatatgattgtgaag
tcttgcaagtgtagctaa

KEGG   Monopterus albus (swamp eel): 109969998
Entry
109969998         CDS       T05607                                 

Definition
(RefSeq) transforming growth factor beta-3-like
  KO
K13377  transforming growth factor beta-3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109969998
   04350 TGF-beta signaling pathway
    109969998
   04068 FoxO signaling pathway
    109969998
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109969998
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109969998
   04218 Cellular senescence
    109969998
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109969998
Cytokines and growth factors [BR:malb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109969998
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109969998
NCBI-ProteinID: XP_020472933
LinkDB
Position
Unknown
AA seq 408 aa
MHLGKALLFVLLLNCATLSSSLSTCATVDIDHVKRKRVEAIRGQILSKLRLTSPPHSLGP
SKIPYDIQALYNSTKELLEELGRNRQQSCGQDNTETEYYAKEIYRFNMVYGPPESNDLPY
CPKGITSKVFRFSVSSMERNSTNLFRAEFRALRVPNSSAKRNEQRIELYQIVRPNEHIRK
QRYIGAKNVLTKGTPEWVSFDVTETVREWLMNRGTNLGLEISVHCPCHTFSPNGDIIDNE
NEVLEVKFRGVDGDEGQSRLDVDPLKKKKEQYQPHLILMMIPPHRLDTRSTHRRKRALDT
NYCFSNTEESCCVRKLHIDFRRDLDWKWIHEPSGYDANYCSGPCPYLRSSDTTHSSLLSL
YNTLNPEASAAPCCVPQDLEPLTILYYSGRTPKVEQLSNMIVKSCKCS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcatttgggtaaggctttactgtttgtcctccttctcaactgcgcaactctgagctca
tctctgtcaacttgtgccaccgtggatattgaccatgtgaaaaggaagagggtcgaagcg
atacgaggtcagattttgagcaaactccggctcacaagtcctccgcactccctcggaccg
agtaaaatcccgtatgacatccaagcactgtataacagcaccaaggagctactggaggag
cttgggaggaatcggcagcaaagttgtggtcaggacaacacagagacagagtactatgcc
aaagagatatacagattcaacatggtctatggaccgccagagagcaatgatttgccctac
tgcccaaagggcatcacctcaaaggttttccgcttcagcgtctcttccatggaaaggaac
tcaaccaacctcttcagagcagagtttcgtgctctgagggtgccaaattcaagtgccaag
aggaatgaacagcggattgagctctaccagattgtgaggccaaatgaacacattaggaaa
caacgctacattggagccaagaatgtgctgaccaaaggtactccagaatgggtctccttc
gatgtgactgaaacagtgcgtgaatggctgatgaaccgaggaaccaatctgggtttggaa
atcagtgtgcactgtccctgccacaccttcagcccaaatggtgacatcattgacaatgag
aacgaggtgctcgaggtgaagtttagaggtgtggatggagatgaggggcagagtcgcttg
gatgtggatccccttaagaaaaaaaaggaacagtaccagcctcaccttatcctcatgatg
atcccaccccaccgcctcgatacgcggtccacacaccggcgcaagagagcgctggacaca
aattactgtttctcaaacacggaggagagctgctgtgttcgcaagctccacattgatttc
cggcgtgacttggactggaaatggatccatgagcccagtggttatgatgccaactactgc
tctgggccctgcccttacctgaggagctcagatacaacacacagctcgctgctgagcctg
tacaacactctgaatccggaggcgtcggccgccccctgctgtgtccctcaagacctggaa
cccctcactatactctactattctggacgaactcccaaagtggagcagctctccaacatg
atagtcaagtcttgcaaatgtagctga

KEGG   Monopterus albus (swamp eel): 109973033
Entry
109973033         CDS       T05607                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109973033 (tgfb2)
   04350 TGF-beta signaling pathway
    109973033 (tgfb2)
   04068 FoxO signaling pathway
    109973033 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109973033 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109973033 (tgfb2)
   04218 Cellular senescence
    109973033 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109973033 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:malb00536]
    109973033 (tgfb2)
Cytokines and growth factors [BR:malb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109973033 (tgfb2)
Glycosaminoglycan binding proteins [BR:malb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109973033 (tgfb2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 109973033
NCBI-ProteinID: XP_020477983
LinkDB
Position
Unknown
AA seq 480 aa
MNLCVVSLFLILDFATMALSLSTCSTLDMDQFKKKRIEAIKGQILSKLKLTSPPENFPEP
EEVSRDIVAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPFYPSENVISP
THFNPYFRRLMFDVSSMEKNASNLVKAELRIFRLQNPGARVPEQRIELYQILGHKDLTSP
TQRYIDSRVVRTQTEGEWLSFDVTEAVSEWLNHRDRNSGFKISLHCPCCTFVPSNNYIIP
NTSEELEARFAGIDDSFTHGSDLKVFKKQRHSARAPHLLLMLLPSYRLESQSQHRNRRAK
RALDAAHCSKNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYEANFCAGACPYLWSADTQHS
KVLGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPRIEQLSNMKTGEITKNWTDDIRG
KYGWISRKRNGSLLQVLLHLGVESRFVKKGALINKVGVWLGFVAAHTINSVNWYNFFSRT
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacctgtgtgtcgtcagtcttttcctcatcttggactttgccaccatggcgctaagt
ttgtccacatgcagcacgctggacatggatcaattcaagaagaagcgcatcgaagctatt
aaagggcaaattctgagtaagctgaagcttaccagccccccggagaacttcccggagcca
gaggaagtgtctcgcgacattgtcgccatttacaacagcacccgggacctactgcaggag
aaggcgaatgaacgggcggcgacgtgcgagcggcagcgaagcgaggaggagtattacgcc
aaggaggtgcacaagatcgacatgcagcccttctacccgtcagagaatgtcatctctcct
acacacttcaacccttacttcaggcgactgatgtttgatgtgtcttccatggagaagaat
gcatctaacttggtgaaggctgagctcaggatcttccgtcttcaaaaccctggggcccga
gtgcctgagcagcgcattgagctctaccagattttaggacacaaagacctgacatcacca
acacaacgatatattgacagcagggtggtacgaacccaaactgagggagagtggctgtct
tttgatgtgacagaggcagtgagtgaatggctgaaccatagagaccgaaacagtggattc
aagatcagcctgcactgcccatgctgcacgtttgtaccatcaaataactacattattccc
aacacgagtgaggagctggaggcacggtttgcaggtattgatgacagctttacccatggc
agtgacctgaaggtatttaagaagcagaggcacagtgctcgggctccacaccttcttctc
atgctgttgccttcataccggctggagtcccagtcccagcacaggaaccgacgagccaag
agagccctggatgctgcccactgctccaaaaatgttcaggacaactgctgtttacggtca
ctctacattgattttaagaaggacctgggttggaggtggatccatgagccaaaggggtat
gaggccaacttctgtgctggggcatgtccttatctgtggagcgccgacacccagcattcc
aaggtgttaggcttgtataacactatcaaccctgaagcatcggcatcaccctgttgcgtc
tcccaggacctggagcccctcaccatcctctactacattggcaagacccccagaatagag
cagctctcaaatatgaagacaggagagattacaaagaattggacagatgacatcagagga
aagtatggatggatatcaaggaaaaggaatggctctttattacaagtactattacattta
ggagttgaatcaagatttgtgaagaagggagcacttataaataaggttggggtgtggtta
gggtttgttgcagcccacactatcaatagtgttaattggtacaattttttcagtaggaca
tag

DBGET integrated database retrieval system