KEGG   Monopterus albus (swamp eel): 109955133Help
Entry
109955133         CDS       T05607                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04012  ErbB signaling pathway
malb04020  Calcium signaling pathway
malb04114  Oocyte meiosis
malb04217  Necroptosis
malb04261  Adrenergic signaling in cardiomyocytes
malb04310  Wnt signaling pathway
malb04912  GnRH signaling pathway
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109955133
   04310 Wnt signaling pathway
    109955133
   04020 Calcium signaling pathway
    109955133
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109955133
   04217 Necroptosis
    109955133
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109955133
   04916 Melanogenesis
    109955133
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109955133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109955133
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109955133
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   109955133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 SnoaL_4 SnoaL_2 Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 109955133
NCBI-ProteinID: XP_020446639
LinkDB All DBs
Position
Unknown
AA seq 477 aa AA seqDB search
MATVICTRFTEEYQLYEELGKGAFSVVRRCVKVLSGQEYAAKIINTKKLSARDHQKLDRE
ARICRLLKHPNIVRLHDSISEEAHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGDQQAWFGFAGTPGYL
SPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPAKRITAAEALKHPWISHRSTVASCMHRQETVECLKKFNARRKLK
GAILTTMLATRNFSGGKSGNKKADGVKESSESTNTTIEDEDTRVRKQDIIKVTEQLIEAI
SNGDFESYTKMCDPAVTAFEPEALGNLVEGLDFHRFYFENLWSKNSKPVHTTILNPHIHL
VGDEAACIAYIRVTQYIDSNGTPRTAQSEETRVWHRRDGKWQIVHFHRSGSPSTLNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggtcatctgtactcgtttcaccgaggagtatcagctgtacgaggagctgggc
aagggagcgttttcggtggtgcgtcgctgtgtgaaggtgctatcaggtcaggagtacgct
gccaagatcatcaacaccaagaaactgtctgccagagatcatcagaagttggaccgtgaa
gctcgaatctgtcgtttactgaaacaccccaacattgttcggctacatgacagcatctca
gaggaggcgcatcattacctcatctttgacctggtaacgggtggagagttatttgaagat
atcgtagccagagaatattacagtgaagctgatgccagtcactgtattcagcagattctg
gaggcggtgctacactgtcaccagatgggtgtagtccaccgagacctgaagccagagaat
ctgctgctggcctccaagtcaaaaggagcagcggtaaaactggctgacttcggcctcgcc
atcgaggtggagggagaccagcaggcctggttcggctttgcagggactccaggttatttg
tctccagaggttttgaggaaggacccgtacggcaaagcagtcgacctctgggcttgtggt
gtgattctctacatcttattggtcggttaccctccgttttgggatgaagatcagcatcgc
ctctaccagcagatcaaagctggagcttatgattttccttctccagagtgggacacggtg
actcctgaagccaaagacctcattaataagatgctgaccatcaatccggccaaacggatc
actgcagccgaggcgctcaaacacccctggatctctcatcgctccacagtggcatcctgt
atgcacagacaggaaaccgtggagtgtctgaagaagttcaacgccagaaggaaactcaag
ggagccatcctcaccaccatgttggccaccagaaatttctccggaggaaagagcggcaac
aagaaggccgacggagtcaaggaatcatctgagagcacaaacaccaccatagaggacgaa
gataccagagtgaggaaacaggacatcattaaagtcactgagcagctcattgaagcgatc
agcaatggggactttgagagctacactaaaatgtgtgacccggctgtgacggcgttcgag
cctgaggcgttgggaaatctggtcgaaggcctggactttcaccgcttttattttgaaaac
ttgtggtctaagaacagcaaacctgtccacaccaccatcctgaaccctcacattcacctg
gtcggggacgaagctgcctgcatcgcctacatcagagtgacgcagtacattgactccaac
ggcacgcctcgcactgcccaatcagaggagaccagggtgtggcaccgccgtgatgggaag
tggcagatagtccacttccatcgctcaggctccccctccacgctcaacaactaa

DBGET integrated database retrieval system