KEGG   Monopterus albus (swamp eel): 109955161Help
Entry
109955161         CDS       T05607                                 

Gene name
gstz1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00350  Tyrosine metabolism
malb01100  Metabolic pathways
Module
malb_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109955161 (gstz1)
Enzymes [BR:malb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     109955161 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 109955161
NCBI-ProteinID: XP_020446708
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MSLASLAKPILHGYFRSSCSWRVRIAFALKGIEYDQVPVNLIQDGGQQHTEQFKTLNPMQ
QVPAVEIDGFTFSQSLAVIQYIDETRPGPRLLPADSKKRAQVRMISDLIASGIQPLQNLH
VIQKIGADKVHWAQYFIERGFQALEPILKQTAGKYCVGDEISMADICLVPQVYNAERFKV
DVGQYPTIKKINQTLVEIEAFKVSHPSCQPDTPADIHA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtccttagctagccttgccaagccaattcttcatggatacttccgaagctcctgctcc
tggagggttcgcattgcttttgctcttaaaggtatcgaatatgaccaggttccagtcaat
ctaatccaagacgggggtcagcagcacacagagcagttcaaaacattaaaccccatgcaa
caagtgcctgcagtggaaattgatggcttcacattttcgcagtcactggcagtgatccag
tacatcgatgagaccagacccgggcctcggctccttccagcagactcaaagaaacgcgcc
caggtccgaatgataagtgatctcattgcctctgggatacagcctctgcagaatttgcat
gtaatccagaagataggagcagacaaagtgcactgggcgcaatatttcattgaacgtggt
tttcaagctcttgagccgattctgaagcagactgcagggaaatactgtgtgggtgatgag
atatccatggctgacatctgcctggttccacaggtctacaatgcagagaggttcaaagtg
gatgtcgggcagtatccaactatcaaaaagataaatcaaaccttagttgagattgaagct
ttcaaagtgagccacccatcttgccaacctgacacacctgctgatattcatgcatga

DBGET integrated database retrieval system