KEGG   Monopterus albus (swamp eel): 109955333
Entry
109955333         CDS       T05607                                 

Definition
(RefSeq) transcription factor E2F5-like isoform X1
  KO
K04682  transcription factor E2F4/5
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109955333
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109955333
   04218 Cellular senescence
    109955333
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109955333
Transcription factors [BR:malb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109955333
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP DivIC MAD FlxA ZapB DUF4140 TSC22
Other DBs
NCBI-GeneID: 109955333
NCBI-ProteinID: XP_020447050
LinkDB
Position
Unknown
AA seq 367 aa
MEFQTTETVCSTSSRQEKSLGLLTMKFVSLLREAKDGVLDLKVAADSLAVKQKRRIYDIT
NVLEGVGLIEKKNKNIIQWRLWRHRGMNSGIQTEEVLEQVKILKAQISELEAQEKELDNQ
KAWLEQNIKHLDQDPSTSTYKFVTHEDICSAFSGDTLLTVVAPVGTRLEVPVPEVGQSSL
KRYQVNLRSDSAPIQVMLINRDSDCKVPVVFPVPPTDDMYPMATSPSTPMSLQRFPHSAL
GYSTSNATSSYCSQDSLCSDHQMVLPGHDEELTPSSSPPDVHMECHSQPAAVLEQQQVDL
VDPEFQSVLDVGSLLKLNSAGDHIKDDREGAVDLIDELISTDGIDYSFNLDGTEGVCDLF
DLQILNY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagtttcaaacgacggagactgtatgctcaacttcgagtcgccaagagaaaagtttg
gggctcctcacgatgaagtttgtcagtcttctacgagaagctaaggacggcgtccttgat
ttgaaagtggctgcagacagcttggcagtgaagcagaagaggaggatatatgacatcaca
aatgtacttgaaggagtggggctgatcgagaagaaaaacaagaatattatccagtggagg
ttgtggaggcacaggggcatgaactcaggcatccaaactgaggaggtgctggagcaggtc
aaaattttaaaggcacagatctctgagctagaggcccaagagaaagagctggacaaccag
aaggcatggctggagcagaacatcaagcaccttgaccaggaccccagtaccagcacttat
aaatttgtgacacatgaagacatctgcagtgctttcagtggagacactcttctcactgtt
gtggctcctgttgggacacgactggaggtgccagtacctgaagtgggccagagtagtctg
aagaggtaccaagtgaacctacgcagtgactcagctcccatccaggtcatgctcatcaat
agggattcagactgcaaagtgcctgtggtcttccctgtgccacccacagacgatatgtat
ccaatggctacctcacccagcacccccatgagcctgcagaggttcccccactcagcgttg
gggtactccacctccaacgctacctcctcctactgcagccaggactctctctgttcagac
caccagatggtgctgccaggacatgatgaagagctaacaccatcatcctctccccctgat
gtgcacatggagtgtcatagtcagccagcagcagtgttggagcagcagcaggtagacctg
gtggacccagagttccagtctgttctggatgtgggcagtctgctgaagctcaactctgct
ggagaccacataaaggacgacagagagggagctgttgacttgattgatgagttaatctcg
actgatggcatagactacagcttcaacctggacggcactgagggagtgtgtgacctgttt
gatttgcagatcctcaattactga

KEGG   Monopterus albus (swamp eel): 109962531
Entry
109962531         CDS       T05607                                 

Gene name
e2f4
Definition
(RefSeq) transcription factor E2F4
  KO
K04682  transcription factor E2F4/5
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109962531 (e2f4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109962531 (e2f4)
   04218 Cellular senescence
    109962531 (e2f4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109962531 (e2f4)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109962531 (e2f4)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 109962531
NCBI-ProteinID: XP_020459983
LinkDB
Position
Unknown
AA seq 392 aa
MMELESASNRSELGAVGDSLQPQTPSRHEKSLGLLTTKFVTLLQEAKDGVLDLKAAADTL
AVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIDLKAELEDLALR
ENELDQQRVWVQQSIKNVTDDSSNSPMAYVKHEDLCGAFKGDTLLAIRAPTGTQLEVPVP
EAALNGQRKYQIRLKSSSGPIEVLLVNKDQSSASPVVLPVPPPDDVFQNLPAPTPTSQPS
SAVSLVPKAAPVISTKPGPTTTSATAANHTASVTEVTSTTPLTPTNDTPATVPQQLQSSS
SLDGSVSSSGSAMFEPIKSDPSELLDFPKELSEMFDPTKEIMSGDLLEDLMSSEVFSPLL
RLSPPPSDHDYIYNLDETEGLCDLFDVPVLNL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgatggagctggagtcggccagtaatagaagcgaactgggagctgtgggagactcgctg
cagccacagaccccgagcaggcacgaaaagagcctgggactgctcacgaccaagtttgtg
actttactacaggaagcgaaggacggagttctggatctgaaagctgctgcagacaccttg
gcagtgcggcagaaacggcgcatctacgacatcactaatgtgctggagggaattgggctt
atagagaagaagtccaagaacagtatccagtggaagggtgtaggcccaggctgtaacact
agggagatagctgataaactgattgatctgaaggctgagctggaagacctggctctccgg
gaaaacgagctggaccagcagagagtttgggtccaacagagcatcaagaatgtcacagat
gactccagcaacagccctatggcttatgtaaaacatgaagacctctgtggagctttcaaa
ggagacacactcctagcaatccgtgctcccactggcacacaactagaggtgcctgtacca
gaagctgccctcaatggacagaggaaataccagatccgtctgaagagctcatctggtccc
atcgaggttttgttggtcaataaggaccagtccagtgcctctcctgttgttttgcctgtc
cctcctccagatgatgtctttcagaacctcccagcaccaacacctacctcccagccatcc
tccgctgtctcattggtccccaaagcagctccagtcatttctacaaaacctggtcccacc
acaacatcagctacagcagccaatcacacagcctcagtgacagaggtgacaagcaccacg
ccactcaccccaacaaatgatacacctgctacagtcccacagcagcttcagtcctcgtcc
tcactggatggatctgtgtcctcttctggctctgcaatgtttgaaccaattaaatcagat
ccttctgaattactggactttcccaaagagctctctgaaatgtttgatccaacaaaagag
atcatgagtggagacctcttggaggacttgatgtcatccgaagtgttctcgcctctcctc
cgtttgtccccaccaccaagcgaccacgactatatatacaacttggatgagacagaaggc
ctgtgtgatctctttgatgtccctgttctcaacctctga

KEGG   Monopterus albus (swamp eel): 109964592
Entry
109964592         CDS       T05607                                 

Definition
(RefSeq) transcription factor E2F4-like isoform X1
  KO
K04682  transcription factor E2F4/5
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109964592
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109964592
   04218 Cellular senescence
    109964592
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109964592
Transcription factors [BR:malb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109964592
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP SKA2 Rx_N
Other DBs
NCBI-GeneID: 109964592
NCBI-ProteinID: XP_020463651
LinkDB
Position
Unknown
AA seq 330 aa
MDLEVGPQSLDHQTATPAQYPKYKRNLRSLNLLTMKFVRLLQEAEDGVLDLKDAVRVLAV
RQRRRIYDITNVLEGIGLIVKIYKNLVKWVGPRPGENAHKLTNRLTELKAELQDLERKEN
MLDQQRLWVQQSIRNTTEECNNLTYVNHEDICNCFSGKTLLVVRGPVGTQLDVPIPKAVL
NSPVTYQIHLKSISGPIEVILLNKRSVSSVPVVLPVPPPEEVLRNAKLAMSTSDETGGSA
AHCQTSTNTKHSATWRQKVMDDMQSLHASSYINTEPNRAAASKFPDLSKELRSLLDSPKE
IMNADLLSQLMASQVFSPLLCLSPPLSEHE
NT seq 993 nt   +upstreamnt  +downstreamnt
atggatcttgaagttggtccacagagtctggatcaccagaccgcaacaccagcccagtac
cccaaatacaagaggaatttgaggagtctaaatttgctgaccatgaagtttgttagatta
ctgcaagaagctgaagacggtgtgctggacctcaaagatgctgtcagggtcctggctgtc
agacagagaaggcgaatctatgacatcacaaatgtgctggagggcattggtctgattgtg
aaaatatataagaaccttgttaagtgggtgggcccgagaccaggagaaaatgcacacaaa
ttaaccaacagactgacagagttaaaggctgagctgcaggacttggagcggaaggaaaat
atgttggaccaacagagactctgggtccaacagagcatcaggaacacaacagaagaatgc
aacaatctgacctatgtgaatcatgaagatatctgcaactgcttcagtggcaagacactc
ctggtagtgcgagggccagttggcacacaactagatgttcccattcccaaagctgtcctg
aacagcccagtaacatatcagatccatctgaaaagcatcagtgggcccatagaagtcata
cttcttaacaaacgttctgtcagctctgttccagttgtactaccagtcccaccaccagaa
gaagttttacggaatgctaaattagccatgtctacttcagatgagacaggtggcagtgct
gcacattgtcagacttcaactaataccaaacatagtgctacatggagacagaaagtcatg
gatgacatgcagtctcttcatgcatcatcatatataaacacagagcctaacagagctgct
gcatctaaatttccagatttatcaaaagaactgaggagcctactagactcacccaaagaa
ataatgaatgcagatctactctcacagcttatggcctctcaagttttttctccacttctc
tgtctgtctccacccctgtctgaacatgaataa

DBGET integrated database retrieval system