KEGG   Monopterus albus (swamp eel): 109955738
Entry
109955738         CDS       T05607                                 

Gene name
steap3
Definition
(RefSeq) metalloreductase STEAP3
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    109955738 (steap3)
   04115 p53 signaling pathway
    109955738 (steap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109955738 (steap3)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     109955738 (steap3)
Membrane trafficking [BR:malb04131]
 Exocytosis
  Others
   Others
    109955738 (steap3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct IlvN NAD_binding_2 2-Hacid_dh_C Shikimate_DH ApbA
Other DBs
NCBI-GeneID: 109955738
NCBI-ProteinID: XP_020447811
LinkDB
Position
Unknown
AA seq 491 aa
MPDDMSRPLIRGRCEGRSSTHLEAAMSEPGAPVIGILGTGDFSRSLARRLVTSGYQVVVG
SRVPKRSQGLFPEEAEVTSQMEAASQADLVFVAVFPEHHSTLVELKPALAGKTLVDVSNG
LRINQEGPSNAEQLADLFPESSVVKGFNTISAWMLQVGPRDGSRQVFLCSDSQQAKSLVM
QVCRRMGFIPVDMGLLSSSLEIENLPLYLFPSWHLPVLCTVFLFFFFYLYNFTRDVLQPY
ITAGKSAFYKMPIEIVNVTLPSVALVMLALVYLPGLFAAFLQLWWGTKYNRFPNWLDRWL
TRRKQFGLCSFLCAVLHAIYSLCLPMRKSARFKLLDAAVKQVKDGLENSWVDTEVWRMEL
YLSVGIMALGLLSLLAVTSLPSVAGTVNWREFSFIQSTLGYCALSMATLHAVFYGWNRAF
VPDHYRFYLPPTFLLVLILPLTVLLGRLALFVPCVAWQLRRIRRGWEKSKHIRFALPDDE
YHNGLEDVSNV
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcctgatgacatgtcaaggcctttaatccgaggcagatgtgagggacgaagctccaca
caccttgaggctgcaatgtctgaacctggtgctccagtgatcggcatcctgggtacgggc
gacttctctcgctcgctggccagaaggctggtgacctcgggctaccaggtggtggtgggg
agtcgagtccccaaacgctctcagggtcttttccctgaagaggctgaggtgacctcccag
atggaggcagccagtcaggcagacctggtctttgtcgctgtgttccctgagcaccactcc
acactggtggaattaaagccagcactagctgggaagacactggtggatgttagcaatggt
ttgcgaatcaaccaagaagggccttccaatgctgaacagctggctgatctgtttccagaa
agttctgtagtcaaagggtttaacaccatatctgcctggatgctgcaggtgggccctcgg
gatggaagcaggcaggttttcctgtgcagtgacagtcaacaggccaagagcttggtgatg
caggtctgtcgcagaatgggcttcattcccgtcgatatgggcctgctgtcctcttctctg
gagatcgagaatctccccttatatctgtttccctcttggcacctccctgtcctttgcacc
gtatttctgttcttcttcttctacctgtacaactttacccgtgatgtcctgcagccctac
atcacagcagggaagagtgctttctacaaaatgcccattgagattgttaatgtcactctt
ccttcagtggccttggtgatgttagcactggtctatctacctggattgtttgctgctttc
ctccagctgtggtggggcaccaagtacaatcgcttccccaactggctggaccggtggctg
accaggaggaagcagtttgggctgtgtagctttttgtgtgcggttttacatgccatctac
agcctgtgtcttcccatgaggaagtccgcccgcttcaaactgctcgacgctgctgttaaa
caggtgaaggacgggctggagaactcatgggtggacacggaggtgtggaggatggagctg
tacctctctgtgggcatcatggcccttgggctgctctctcttctggctgtcacctctctg
ccttctgtggccggcactgtcaactggagggagttcagcttcatacagtccacactaggt
tactgtgccttgtccatggccaccctccatgcagtcttctatggctggaaccgtgccttc
gtcccagaccattaccgcttctacctgcctcccaccttcttactcgttctgattcttccc
ttgacggttctgctgggccgcctggctctcttcgtgccttgcgtggcctggcagctcaga
cggatccgtcgcggctgggagaagagcaagcacatccgcttcgccctgccggatgacgaa
taccacaacgggctggaggatgtcagcaatgtgtga

DBGET integrated database retrieval system