KEGG   Monopterus albus (swamp eel): 109956058
Entry
109956058         CDS       T05607                                 

Gene name
mdm4
Definition
(RefSeq) protein Mdm4 isoform X1
  KO
K10127  protein Mdm4
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109956058 (mdm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:malb04121]
    109956058 (mdm4)
Ubiquitin system [BR:malb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    109956058 (mdm4)
SSDB
Motif
Pfam: SWIB zf-C3HC4_3 zf-RanBP
Other DBs
NCBI-GeneID: 109956058
NCBI-ProteinID: XP_020448520
LinkDB
Position
Unknown
AA seq 506 aa
MSSNKRFCSFTMSSLSAQPSASSSSCRTLPGEGNQVQPKAPLLQILRVAGAQEEVFTLKE
VMHYLGQYIMGKQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYLVVLGC
ADAAENLSVGRECVEGGVEDHGQMCGGVVKAGLEASSDGPLLQTPSQRRPREPDDDSLEG
LPRSACKRPKLDVTLDEWDLSGLPWWFLGNLRSNYSRRSNGSTDIRTNQLSLAQEEDTAI
VSDTTDDLWFLTEGESEQVSVEMKEAALEEGSGGEGEIPPDDDDGGTEEKADREMQEEPD
DDSQCLSDDTDTEISIQDAWQCTECRKYNTPVRRYCVRCWALRKNWYKDVPRLAHSLSVP
DIAACSSLTTHNEEDDSDTGIDVPDCSRTVSDPVILPSHSTADRPLAIVVRGKDKGPRPS
GFHKDEQLSGGESQENLGMEVEEVRPEALLEPCKLCRVRPRNGNIIHGRTAHLITCFPCA
RKLHKFQAPCPGCGKIIQKVIKIFIL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtcgtcgaacaaaagattttgttcgtttactatgagctctctatcagcccagccttct
gcttcaagctcgtcatgcaggactctacctggagagggaaatcaggtacaaccaaaagct
cctctcctgcagattctgcgtgttgctggagcccaggaagaagtctttacgctcaaagag
gtgatgcactacttgggtcagtatatcatggggaagcaactgtacgataaacagaggcag
catatagtccactgccaggatgaccctttgggagagctgctggaagtggagagcttctct
gtcaaaaacccaagcccggtgtatgaaatgctcaagaagtacttggttgtacttggttgt
gcggacgctgcagagaatctttctgtgggccgtgaatgtgtagagggcggagtggaggat
catggtcagatgtgtggaggtgtggtcaaagcaggactggaggccagcagtgatgggcct
ctcctgcagaccccctcccagagacgacctcgggagccagacgatgactcacttgaaggc
ctgccacggtcagcctgcaaacggcccaaactggatgttactctggatgagtgggatctc
tccggcctgccatggtggtttctgggtaatctccgtagtaactatagccgtaggagcaat
ggctccaccgacatccgcacaaaccaactgtctcttgcacaggaggaggacacggccatc
gtatcggacaccactgatgacctctggttcctcactgagggtgagagtgaacaggtcagt
gtggaaatgaaagaggctgcgctggaggaagggagtgggggagaaggggagatcccccct
gacgatgatgatggagggacagaggagaaggccgatcgagagatgcaggaggagccagat
gatgattctcagtgccttagcgatgacactgatacagagatctccatacaggatgcatgg
cagtgtacagagtgcaggaagtataacacacctgtgcggaggtactgtgttcgctgctgg
gctctacgaaagaactggtacaaagatgtccctcgacttgcccattccctttctgttcct
gatattgcagcatgcagctctctcactactcataatgaagaagatgacagtgacacaggc
attgatgtcccagattgcagcaggacagtatctgaccccgtcatcctgccctcccactcc
acagctgaccgaccactagccattgtggtcagggggaaagacaaagggcctcggccctca
ggcttccataaggatgaacagctttcaggaggggagagtcaggaaaatctaggcatggag
gttgaagaagtgaggcccgaggcactgctggagccttgcaagctctgtcgagtgcgacca
cgcaatggaaatataatacatggacgtacggctcacctaataacctgcttcccatgcgca
aggaagctacacaagttccaggccccttgtcctgggtgtggaaagattattcaaaaagtt
atcaagatattcatcctctaa

DBGET integrated database retrieval system