KEGG   Monopterus albus (swamp eel): 109956190
Entry
109956190         CDS       T05607                                 

Gene name
cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04530  Tight junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109956190 (cdk4)
   04115 p53 signaling pathway
    109956190 (cdk4)
   04218 Cellular senescence
    109956190 (cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109956190 (cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109956190 (cdk4)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109956190 (cdk4)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109956190 (cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 109956190
NCBI-ProteinID: XP_020448787
LinkDB
Position
Unknown
AA seq 310 aa
MAHATSIQYEPVAEIGGGAYGTVFKARDIQSGQFVALKSVRVQTDQNGLPISTVREVAVL
KRLEQFDHPNVVRLMDVCAIQRSDQETKVTLVFEHVDQDLKTYLERTPAPGLSPERIKDL
MRQLLCGLAFLHSNRVMHRDLKPENILVTSQGQVKLADFGLARIYSCHMALTPVVVTLWY
RPPEVLLQSSYATPVDIWSTGCIFAEMFRRKPLFCGESEVDQLGKIFEVIGLPPEEEWPT
DVTLTRKNFPPNMPRPIADFVPEISEQGAQLLLKMLTFDPLKRISALNALEHSYFQDGET
LSQTKAKVMQ
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcccatgccaccagtatccagtatgagccagtggcagagatcggaggaggcgcttac
gggactgtttttaaggcccgagacatacagagcggacaatttgttgctctaaagagtgta
cgtgtccagacagaccaaaatggcctgccaatctccacagtcagggaggtggctgtattg
aaaaggctggagcagtttgaccacccaaatgtggtcaggctcatggatgtatgcgccatc
cagaggtcggaccaggagactaaagtcactctggtgtttgagcatgtggaccaagacctc
aagacgtacctcgagagaactccagctcctggattatctcctgaacgcatcaaagacctg
atgaggcagttgctgtgtggtcttgcattccttcactctaatcgtgtgatgcacagagac
ttgaaaccagagaatattctggtaaccagtcagggccaggtgaaactggctgactttgga
ctggccaggatctacagctgccacatggccctcacccctgtggtggtgacactgtggtat
cggcctcctgaggttctgctacagtccagttatgccacacctgtggacatctggagcact
ggctgcatctttgctgagatgttcaggcgcaaacctttgttctgtggagaatcagaagtg
gaccaacttgggaaaatttttgaagttattggcttgccaccagaagaggagtggccgact
gatgttacactgacaagaaaaaactttccccccaacatgccacggccaatcgctgacttt
gttccagagattagcgagcagggggcgcaactattgctgaaaatgttgacgtttgacccc
ttgaaacgaatatcagccctgaatgcactagaacattcctatttccaggatggggagaca
ttgagtcagacaaaagctaaagtgatgcaatga

KEGG   Monopterus albus (swamp eel): 109963185
Entry
109963185         CDS       T05607                                 

Definition
(RefSeq) cyclin-dependent kinase 6-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109963185
   04115 p53 signaling pathway
    109963185
   04218 Cellular senescence
    109963185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109963185
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109963185
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109963185
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Pox_ser-thr_kin Herpes_UL21
Other DBs
NCBI-GeneID: 109963185
NCBI-ProteinID: XP_020461182
LinkDB
Position
Unknown
AA seq 300 aa
MEPSTKPLSYELLVEIGKGSYGKVYKAREMGEKQRLLAVKKFNTRVDTSETGIPAFIIRE
VALLCKMKYFNHPNIVKLLDASAVSVGRNLDLTLVLEYIDQDLSTYLSKVPVSGLSHDCI
KDVMLQLLQGLDFLHTNMVLHRDLKPENILISSHGEVKIADFGLARLYTFNIALTPGVVT
LWYRAPEVLLNSVYMSSVDMWSAGCIFAELFLLRPLFQAYTEVQQLQKIFEVIGLPSEED
WPKDSPVSYAVDWGPKDSSTKLLPVLGPAENDLLSQCLAFRPSSRISAAKALAHPFFMKH
NT seq 903 nt   +upstreamnt  +downstreamnt
atggaacccagcactaaacctttgtcctacgagctcctggtggaaattgggaaaggctcc
tacggtaaagtgtacaaagccagagagatgggggagaaacagcgcctcctggcggtgaag
aaattcaacacccgcgtagacacttcagaaaccggaatccctgccttcatcatccgagag
gtggcgctgctgtgtaaaatgaaatacttcaaccatcccaacatagtcaagctgttggac
gcctctgctgtatcagtgggcaggaacttggacctcactctggtgctggaatacattgat
caggacctgtccacttacctttccaaggtccctgtttctggactaagccatgactgtatt
aaggatgtgatgttgcagctgctgcaaggactggactttttacacacaaacatggtgctg
caccgtgacttaaaaccagaaaacatcctgatcagcagccatggagaagtcaagattgca
gactttggactggcacgactctatacctttaatatcgctctcactccaggtgtggtgacg
ctctggtacagagcgcctgaggtgctgctgaactctgtttacatgtcctccgtggacatg
tggagcgctggctgcatcttcgctgagctcttcctcctgagacctttgtttcaggcgtac
acggaggtgcagcagctgcaaaaaatctttgaggttattggtttgcccagcgaggaggac
tggcccaaggacagcccagtctcgtatgcagtcgactggggaccaaaagactcctccacc
aagctgcttcctgtcctgggcccagccgagaatgacctattatcacaatgtttggcattc
agaccaagcagtcgcatctctgctgccaaagccctggctcatcctttcttcatgaagcac
tga

KEGG   Monopterus albus (swamp eel): 109968183
Entry
109968183         CDS       T05607                                 

Gene name
cdk6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109968183 (cdk6)
   04115 p53 signaling pathway
    109968183 (cdk6)
   04218 Cellular senescence
    109968183 (cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109968183 (cdk6)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109968183 (cdk6)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109968183 (cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 FTA2 Kinase-like
Other DBs
NCBI-GeneID: 109968183
NCBI-ProteinID: XP_020469912
LinkDB
Position
Unknown
AA seq 325 aa
MDKESIGTQYEPVAEIGEGAYGKVYKARDLKNGGRFVALKRVRVQSEEEGMPLSTIREVA
VLKQLEAFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLEKAPDPGVPPETIK
DMMYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSAEDW
PQEVALPQSAFTPRPPKPIEDLVPDMDEQGRALLMQFLAFNPSRRISAFDALSHPYFQSV
DSHSRSVYAAQPIPSNKPTMEERTA
NT seq 978 nt   +upstreamnt  +downstreamnt
atggacaaagaaagtattggtactcaatatgagcctgtggccgagattggagaaggcgct
tatgggaaagtgtacaaggcgagagatctgaagaacgggggacgctttgtagccctaaaa
agagttcgtgtccagtcggaagaagaaggtatgcctctctccaccatccgggaggtggcg
gtactgaagcagcttgaagcctttgagcaccccaatgttgtcaggttgtttgacgtgtgc
acagtctcacggactgaccgagaaaccaaactcactctggtctttgagcacgttgatcag
gatctgaccacctacctggagaaggcccctgacccaggagtaccacctgagaccatcaag
gatatgatgtaccagctgctccagggactggacttcctgcattcacaccgagtggtccac
cgtgacctgaaaccccagaatatcctggttaccagcggaggacagatcaaactggccgac
tttggtctagcacgcatttacagcttccagatggcactcacctctgtggtggtgacattg
tggtacagagccccagaagtgctgctccagtccagttatgcaacaccagtggacctgtgg
agtgttggctgcatcttcgctgagatgttcaggagaaggccgctgtttcgaggaaactca
gatgttgatcagctggggaagatttttgatgttgttggggtaccttcagcagaggactgg
ccccaggaggtggcccttccacagagtgccttcaccccacggccacctaagccaatagaa
gacttggttccggacatggatgagcaaggacgggctctcttaatgcaattcctcgccttt
aacccctccaggagaatatcagcctttgatgcactgagtcacccctattttcaaagtgtg
gacagccacagtcgaagtgtgtacgcggcccagcctatccccagcaacaagcccactatg
gaggagaggactgcctga

DBGET integrated database retrieval system