KEGG   Monopterus albus (swamp eel): 109956208Help
Entry
109956208         CDS       T05607                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:malb01002]
    109956208 (pcsk1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:malb03110]
    109956208 (pcsk1)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     109956208 (pcsk1)
Peptidases [BR:malb01002]
 Serine Peptidases
  Family S8: subtilisin family
   109956208 (pcsk1)
Chaperones and folding catalysts [BR:malb03110]
 Intramolecular chaperones
  Subtilisin family
   109956208 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 109956208
NCBI-ProteinID: XP_020448814
LinkDB All DBs
Position
Unknown
AA seq 769 aa AA seqDB search
MEVRCRPAVMCCLFAILCAMVPRSLESSYTDRQYLNEWAVEIPGGLTAAEAIAKELDYEL
VRQIGALENHFLFKHRNHPGRMKRGADHITRQLSEDDRVLWAEQQYEKRRSKRASLRECR
DCPVDKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWN
HTDIYSNYDAAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSADLHNECTQTHTGTSASAPLAAGIFALALEKNPDLTWRDLQHIVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPATWKHVPEKKQCIVRDDS
FQPRELKAAGEITIEIPTKACEGQGNTVHSLEHVQVEASIEYTRRGDLHITLTSPAGTST
VLLAERERDTSSNGFRNWDFMSVHSWGEDPAGTWTLKITDTSGRMENKGRILSWKLILHG
TTEKPEHMKKPRVYIPYNAVQNDRRGVEHMDDMMEEPTQAHSPQKTETAQASPPSSSKKE
PKQPSDSPYSRSLALLRLLQTAFNRHIPALSQPPAIGRASSAWRSFSPPATRLPPQQLYQ
AMDMINKYRGTGDSIYSDYSDGFYSAKPYRHRDDRLLQALFEMIDHDSK
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagatgtcgtccagcggtgatgtgttgcttgtttgccatcctctgtgcgatg
gttccccggtcgctggagtcttcgtacacggacaggcagtacctgaacgagtgggcagtg
gagatcccaggcgggctgacggctgcggaggctattgccaaagaactggactacgaactg
gtccgacagattggggccctggaaaaccacttcttgttcaagcatcgcaatcatcctggc
agaatgaaaagaggtgccgaccacatcaccaggcagctgtcggaggacgatcgagtgttg
tgggcagagcagcagtatgagaaacgtcgcagcaagagggcttccctcagagagtgcagg
gactgcccggtggataagctgtttgatgatcccatgtggaaccagcagtggtacctgcaa
gacacacggacgtcctcctcgctgccgaagctggacctgcacgtgatccccgtgtggcag
aaaggcatcacagggaaaggagtggtcatcaccgttctggatgacgggctggagtggaac
cacacagacatctactccaactacgatgcagcagccagctatgatttcaatgacaatgac
ccggaccccttccccagatatgactccactaatgaaaacaagcatgggaccaggtgtgct
ggagagatcgctatgcaggcagacaacaataaatgtggagttggagtggcatacaattct
aaagttggaggcattcgtatgctggatggcattgtcactgatgccattgaggccagctct
attgggttcaatccagaccatgtggacatctacagtgccagctggggacccaatgatgat
ggaaagacagtggagggtcccggccgcctggcccagaaggcctttgaatatggtatccag
aagggtcgtggtgggaaaggctctatctttgtttgggcatctggtaatggtggccggcag
ggagataactgtgactgtgatggctacacagacagcatttacactatctcaatcagcagc
gcctcccagcagggcttgtccccgtggtacgctgagaaatgctcctctactctggctaca
gcgtacagcagtggagactacaccgaccagaggattacaagtgctgatctgcacaatgag
tgcactcagactcacactggaacatcagcctctgccccattggctgctgggatatttgcc
ctggcactggaaaaaaatccagatctaacctggagagacctgcagcacattgtggtctgg
acttcagagtttgatcctttggctaataacccaggctggaagaggaacggagcaggactg
atggtcaacagtcgttttggcttcggccttctcaatgccaaagccctggtggacctcgct
gacccggccacctggaagcacgtgcctgaaaaaaagcagtgtattgtcagagatgactct
ttccagccaagggagctgaaagcagccggggagatcactatagagattccaaccaaagcc
tgtgagggacaggggaacacagtccattcactggagcatgtgcaggtggaggccagcatt
gaatacaccaggagaggggacctgcatatcacactcacctccccagctggcaccagtaca
gtgctgctggctgagcgggagagggacacgtcatctaatggcttcagaaactgggacttc
atgtctgttcattcatggggagaagatcctgctggtacatggacactgaagatcacagac
acttcgggccgtatggagaacaagggtcggattttgagctggaagttgattctgcacgga
acaacagagaagccagagcacatgaagaaacccagagtctatattccctataacgcagtg
cagaatgacaggcgtggtgtggaacatatggatgacatgatggaggagcccacacaggca
cattcacctcagaagacagagactgcacaagcctctcctccttccagctctaagaaagag
cccaaacagccctcagattcaccctactcccgctccctggccctgctgcgtctcctgcag
acggccttcaacaggcatatcccagccctgtcgcagcctccggccataggtcgggcctcc
tctgcctggaggagcttctctcctcctgctactagactcccaccccagcagctgtaccaa
gctatggatatgatcaacaagtaccggggcactggggacagtatctacagtgactacagt
gatggcttctacagtgccaagccatacaggcacagagatgaccgactgctgcaggccctg
tttgaaatgatagatcatgacagcaaatga

DBGET integrated database retrieval system