KEGG   Monopterus albus (swamp eel): 109956293
Entry
109956293         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04137  Mitophagy - animal
malb04140  Autophagy - animal
malb04210  Apoptosis
malb04621  NOD-like receptor signaling pathway
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109956293
   04137 Mitophagy - animal
    109956293
  09143 Cell growth and death
   04210 Apoptosis
    109956293
   04115 p53 signaling pathway
    109956293
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109956293
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109956293
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109956293
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109956293
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:malb02000]
    109956293
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109956293
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109956293
Transporters [BR:malb02000]
 Other transporters
  Pores ion channels [TC:1]
   109956293
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 109956293
NCBI-ProteinID: XP_020448939
LinkDB
Position
Unknown
AA seq 212 aa
MSYSHRELVEFYISYKLSQRNYSTSLLRPENAGGRTEGDRTNPATTNGLLGNPGWEGGSG
IEAVKAALRDSADEFELRFTQAFSDLSSQLVITPDTAYNSFKSVMDEVFKDGVNWGRIVG
LFAFGGALCVECVEKNMSELVSRIADWMTMYLDEHISPWIQNQGGWDCFAEIFGRDNAAE
VRRSQETLRRWLLVGVVLLTGVLVGVLVAKKL
NT seq 639 nt   +upstreamnt  +downstreamnt
atgtcgtacagtcacagagagctggtggagttctatataagctacaagttgtctcagaga
aactactcaacctctctgctgaggccggaaaacgctggtggaaggactgagggagacagg
accaacccagctaccactaacggcctgctgggcaatccgggatgggaggggggcagtggc
atagaggctgtaaaggctgctcttagggactctgctgatgagtttgaactgcgcttcaca
caagcatttagtgacctttcctcgcagcttgtcatcactcctgacacagcctacaacagc
tttaaaagcgtgatggatgaagtgttcaaagatggagtcaactggggacgtattgtgggc
ttgtttgcttttggtggtgcactgtgtgtggaatgcgtcgagaagaatatgagtgagctg
gtgtcccgcatcgcagactggatgaccatgtacctggatgagcacatcagtccgtggatc
cagaaccaaggaggctgggactgctttgcagagatttttgggcgagataacgctgcagaa
gtgcgaagatctcaggagaccctgaggagatggctgctagttggagtggtgctgctaaca
ggagtgctggttggtgtgcttgtcgctaagaaattgtga

KEGG   Monopterus albus (swamp eel): 109974129
Entry
109974129         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04137  Mitophagy - animal
malb04140  Autophagy - animal
malb04210  Apoptosis
malb04621  NOD-like receptor signaling pathway
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109974129
   04137 Mitophagy - animal
    109974129
  09143 Cell growth and death
   04210 Apoptosis
    109974129
   04115 p53 signaling pathway
    109974129
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109974129
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109974129
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109974129
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109974129
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:malb02000]
    109974129
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109974129
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109974129
Transporters [BR:malb02000]
 Other transporters
  Pores ion channels [TC:1]
   109974129
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 109974129
NCBI-ProteinID: XP_020479816
LinkDB
Position
Unknown
AA seq 256 aa
MSQNKELVVFYITYKLSQKNYPLSHLGLNESPNRTDGEEATHANGTFNGTSPGTPPASPL
RQQQLPSTANLDAVKEALRDSANEFELRYARAFSDLHHQLHITPATAYQSFESVMDEVFR
DGVNWGRIIGLFAFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQPWIQGQGGWERFA
ELFGQDAAAENRRSQESFKKWLLAGMTLVTGVVVGHSSSRNACEGRQGTARLTLFSHEPL
HLPPSVPSTCTPQELK
NT seq 771 nt   +upstreamnt  +downstreamnt
atgtctcaaaacaaagaactggtggttttctacataacatataaactctcccagaaaaac
tatcctctcagccacttgggactaaatgagtctccaaacaggactgatggagaggaggca
acgcacgccaatgggacttttaacggcaccagtcccgggacccccccagcatccccgcta
aggcaacaacagttgccatcaacggcaaacctggatgcggtgaaagaggccctccgggac
tcagccaatgagtttgagctgcgatatgcccgtgctttcagtgatctgcaccaccagctg
catatcacaccagccacggcctaccaaagctttgagagcgtgatggatgaagtgttccgg
gacggcgtcaactggggccgcatcatagggctttttgcatttggcggggcgttgtgtgtc
gagtgtgtggagaaagagatgagtccgctggtgggtaggattgtagagtggatgacagtc
tacctggataaccacattcagccctggatccaaggccaaggaggatgggagcgctttgct
gaactctttgggcaggatgcggcggcagagaacaggaggtctcaggagagcttcaagaag
tggctgctggcggggatgaccctggtgaccggcgtcgtggtgggccactcatcatccaga
aacgcctgtgaggggagacaggggacagcccgactgacactcttctcccatgagcctctc
cacttgcctccttcagtaccctcaacctgcacaccacaggagttgaaatga

DBGET integrated database retrieval system