KEGG   Monopterus albus (swamp eel): 109956323
Entry
109956323         CDS       T05607                                 

Gene name
gtse1
Definition
(RefSeq) G2 and S phase-expressed protein 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109956323 (gtse1)
SSDB
Motif
Pfam: GTSE1_N DUF1138
Other DBs
NCBI-GeneID: 109956323
NCBI-ProteinID: XP_020448979
LinkDB
Position
Unknown
AA seq 715 aa
MNCRTNSDVFFLSDEKFDFDVPMSPDCSKSEEDDEVFAGPIDYTERRAAANLESQIEEGG
DGMRPSWSPLSSDQLEAVCQEALRLATQLQSGELSQLHSDDDGTATTMPNKEFIQDTETK
LAVFCQPAFTLSPIKRQTFCVQDSPMKQLPPAIQHRLLKGRGANTASSTHPSATNVPSST
RPGARLSTSSPVAGAKAPPRAVLRGKAALGVGVVLPSKPAVLASSISASKSKVEKTRLQP
LQPLSKDVGSWKRSPASRLSSRAESYEDLLSDSTSVASDISDSSLNSSLMGKRTLAPPTK
SVVRNVSGVKALSLQNRRVTDRKNTSSSSSSVSSFNSSLSLSPAKGKLNSSLNRSVSGST
GPTPSRVSKPASHSRPRCSTVYGAIEPTSSTTSRRSLSVQARKLSEPEHAKAARSTSLKR
AEATPLQPTPTKRVLDRAANIPTVTAVQPQTGLKARPKPEAVVLPILSGVGRGVQQGDDV
SKMLKPKRLMSAKRKDSLPQKPAAGPLTPSAGDVRLLQVKMRRPSALPTPVRHKACAVPS
PGNQARLAKLLPTSDPYPDPSSASPRREGSSSSTPIDTQEVEPVDIPGIQPFCLEVEEMT
LPAAPPSSAPQPDQSESTDSGATSEDQSEPSRNLIELESAEEITSKTQEVLLLDLPAPTL
QPQEKLLIDLTNTPNLIRTSSKTHPTTQLIDLSSPLIKWSPEDKKENTLLINLSF
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgaactgtcgaactaacagcgatgtgttctttctgtctgatgagaaatttgacttcgat
gttcccatgtcacctgactgctccaaaagtgaagaagatgatgaggtgtttgcaggtcca
attgattatactgagaggcgtgctgctgctaacttggagtcccagattgaagagggtggt
gatggtatgcgaccgagctggagcccgctgagcagcgatcagctggaggctgtgtgtcag
gaagccctcagactagccacccagctgcagagtggcgagctgagccagctgcacagtgac
gacgatgggactgcaaccaccatgcccaataaggagttcatccaggacacagagactaaa
ctggctgtgttctgtcagcccgcctttacactcagcccgatcaaacggcagactttttgt
gtgcaggacagccccatgaagcagctgccacctgctattcagcaccgcctgctgaaagga
agaggcgccaatacagcttcctccacccaccccagtgccaccaatgtgccttcctccacc
cgccccggtgccagactcagcacctccagccctgtggccggggccaaggctccacccagg
gcggtgctgcgaggaaaagctgctttgggtgttggtgttgtgttgccgagcaaacctgct
gttctggcatcttccatttcagccagcaaaagcaaagtggagaaaaccagactgcaaccc
ctgcaaccactgagcaaagacgtgggaagttggaagcggagcccagcctctcgactttcc
agcagggcagagtcgtatgaggatctgctctctgattcaacgagtgtggcctctgacatc
agcgattcctccctcaactccagcttgatgggaaaacgcactctggctccacccacgaag
agtgttgtgaggaatgtgtcgggggtgaaggctctatcccttcagaacaggagggtgaca
gacaggaagaacacatcctcatcctcgtcctcagtgtccagcttcaactccagcctgtct
ctgtcccccgctaaaggtaaactgaactcttctctaaaccggagtgtaagcggctccact
ggccccacccccagcagagtcagcaaaccagccagtcatagcagaccacggtgctccact
gtctatggtgccatagagccaacatcctccaccaccagtcgccgctcactgtctgtccaa
gccaggaagctgtctgagccggagcacgctaaagctgccaggtccacgtcactgaagaga
gctgaggctacgcccctccagccgacacccaccaagagggttttggacagagccgccaac
atccccactgtcaccgcagtgcagccgcagactgggctgaaggccagacccaaacctgag
gctgtggtcctgccgatacttagcggagtaggcagaggagtccaacagggagacgatgtc
tcaaagatgctgaagccaaaacgactgatgtcagcgaaaagaaaggacagtcttcctcag
aagcccgctgctggtcctctgacgccctctgcaggtgacgtcaggttgctgcaggtgaag
atgcggcgtccctctgccctccccacgccagtgaggcacaaggcctgtgctgtcccctca
cctggcaaccaggcccggctcgccaagctgctgcccacctctgacccttaccctgatccc
agctccgcttcgcccaggagagagggcagctctagctccacccccatagacacacaggag
gtggagccagttgacatccctggcatccagcccttctgtctggaggtggaggaaatgaca
ctccctgctgccccgcccagcagtgccccacagcctgaccaatcagagagcacagattct
ggagcaacgagtgaggaccagtcagagcccagtagaaacctgatcgaactggagagtgca
gaggagatcaccagcaagacgcaggaggttctcctgttggatcttccagctccaactctg
cagcctcaagagaaactgctcatcgacttgaccaacacccccaacctgatccgcaccagc
agcaagacccacccaacaactcagctgatcgacctgagctctccgctcatcaagtggagt
ccagaggacaagaaagagaacactctgctcatcaacctgtccttctga

DBGET integrated database retrieval system