KEGG   Monopterus albus (swamp eel): 109956329
Entry
109956329         CDS       T05607                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109956329 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109956329 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109956329 (kitlg)
Cytokines and growth factors [BR:malb04052]
 Growth factors
  Growth factors (RTK binding)
   109956329 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 109956329
NCBI-ProteinID: XP_020448990
LinkDB
Position
Unknown
AA seq 273 aa
MKKSKIWIHTCVHSLLFITLGVYSSKFDVNPVTDDISRLSILKQNIPKDYKIPVHYIPKE
EGGMCWVKLNVFYLEESLKDLGHKFGNISSNKKDISIFIQMLQELRINMGSLEPIMYDFE
CHYRKERWQTAQYFDFVKDFLIAAQNNKDSDDCDPPPCPSQPDPVDGEEITTENCSSTTS
SNGSDCQTDRNPHPSKGTLYLSEVVERSLLSLLFIPLIALLILFVCKVRSRRREEDLQQN
PGEGGLFTGTEGTVPTLDAEITEKSMLNVIETV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacacacctgtgtccattcactgctgttcatcacgctt
ggggtatattcaagtaaatttgacgtcaacccagtgacagatgacatctctagactttct
attttgaaacaaaatattcctaaagattataaaattcctgtacattacattccaaaagag
gagggtgggatgtgttgggtaaaattaaatgtcttctatttggaggagagtttaaaagat
ttaggacataagtttggaaacatttcatctaacaaaaaagatattagcatattcatccaa
atgctccaagaactgcggatcaacatggggtcactggaaccaatcatgtatgatttcgag
tgtcactacaggaaagagaggtggcagacagcacaatactttgactttgtcaaagacttc
cttatagctgcacagaataacaaagattcagatgactgtgatcctcctccttgtccctcc
caaccagacccagtagatggagaagagatcacaacagaaaactgctcctccacgaccagc
agtaatggctcagactgtcaaacagaccgcaatccacacccaagtaaaggaacattatac
ctgtctgaggtggtggagcgaagccttctatctttactcttcattccactcatagccctt
ctaatcctgtttgtgtgcaaggtcaggtcacgcaggcgtgaggaggatcttcaacagaat
cctggagaaggtggacttttcacaggaacagaagggactgtacctacactagatgctgaa
ataacagagaaaagcatgttgaacgtcatagaaacggtgtaa

DBGET integrated database retrieval system