KEGG   Monopterus albus (swamp eel): 109957142
Entry
109957142         CDS       T05607                                 

Gene name
rprm
Definition
(RefSeq) protein reprimo
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109957142 (rprm)
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 109957142
NCBI-ProteinID: XP_020450454
LinkDB
Position
Unknown
AA seq 101 aa
MNNTGFNETQGGLFNKTEFLCSNLSSVVTDNGFVATVPDERSLFIMRVVQIAVMCVLSLT
VVFGIFFLGCNLLIKSEGMINFLVTDRRPSKEAEAVIIGAY
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaataacaccggattcaacgaaacgcagggtggactgttcaacaagactgagtttctc
tgctccaacttatcatccgtggtgactgataatggctttgtggccacagttcccgatgag
aggagcctgtttatcatgagggtggtccagatagccgtcatgtgcgttttgtccctgacg
gtggtgtttggcatatttttcttgggttgcaaccttcttataaagtcagaaggaatgatc
aactttttggtaacggacaggagaccgtcaaaagaagcggaggcggttattatcggggcg
tactga

KEGG   Monopterus albus (swamp eel): 109964243
Entry
109964243         CDS       T05607                                 

Definition
(RefSeq) reprimo-like protein
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109964243
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 109964243
NCBI-ProteinID: XP_020463066
LinkDB
Position
Unknown
AA seq 109 aa
MNDSFFNMTQGALFNGSLAETLATYSGNGTDDVVTGDGGGSLVLLQEERKLFVMRVVQIA
VLCVLSLTVVFGVFFLGCNLMIKSESMINFLVKDRRPSKDVETIMIGLS
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaacgactccttcttcaacatgactcagggcgctctgtttaacgggagccttgccgag
actctggcaacatattccggcaatggtaccgacgatgtggtgaccggtgacggtggaggg
tccctggtgctgctgcaggaggagcgcaaactcttcgtcatgcgcgtggtgcaaatcgcg
gtgctgtgcgtattgtcactcaccgtagtgtttggcgtgttttttctggggtgcaacttg
atgatcaaatcggagagcatgattaacttcctcgtgaaggaccggagaccctccaaagac
gtggagactatcatgatcggactcagctag

DBGET integrated database retrieval system