KEGG   Monopterus albus (swamp eel): 109957512
Entry
109957512         CDS       T05607                                 

Gene name
casp3
Definition
(RefSeq) caspase-3 isoform X1
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109957512 (casp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109957512 (casp3)
   04115 p53 signaling pathway
    109957512 (casp3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109957512 (casp3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109957512 (casp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:malb01002]
    109957512 (casp3)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109957512 (casp3)
Peptidases and inhibitors [BR:malb01002]
 Cysteine peptidases
  Family C14: caspase family
   109957512 (casp3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 109957512
NCBI-ProteinID: XP_020451081
LinkDB
Position
Unknown
AA seq 292 aa
MAGVHGSGGKQSGGDTVDALKWSGKRSDAVGNTTGEMQSVSSNNKAAGSDPYRYKMDYPC
LGKCVIINNKNFHSSTGMTARNGTDVDAAFAIKTFTDLGYKIKVENDLTVEKINQLLSSV
SEEDHSGSASFACVLLSHGDEGVIYGTDGCEKFENLTKYFKGDRCRSLVGKPKLFFIQAC
RGSDLDGGIETDSVEEQTSERIPVEADFLYAYSTAPGYYSWRNTYNGSWFIQALCEMLQR
HKGELELMQIMTRVNHKVALDFESSSNLPGFSGKKQIPCIVSMLTKDFYFPK
NT seq 879 nt   +upstreamnt  +downstreamnt
atggctggggttcacggtagtggtggcaagcagagtggtggggacactgtggatgcctta
aaatggtcgggaaagaggtcagatgcagtaggtaatactactggggaaatgcagtctgtc
tccagcaacaataaagcagcaggttctgacccttaccgctacaagatggactacccctgc
cttggaaagtgtgttattatcaacaataagaacttccacagtagcacagggatgaccgct
cgtaatgggacggatgtagatgccgcttttgctatcaagacgttcactgatctgggttat
aagatcaaagtggagaacgacctgactgtggaaaagataaatcagcttctgtcaagtgta
tccgaggaggaccacagtggaagtgcatcatttgcatgtgtgttgctaagtcatggagat
gagggggtgatatatggcacagacggctgtgaaaagtttgaaaacctgacaaaatacttt
aaaggagaccgctgcaggagcctggtggggaaaccaaagctctttttcatacaggcgtgc
cgcggttcagacctggatggtgggatcgagactgacagtgtagaagagcaaacatcagag
aggattcctgtggaggcagacttcctctatgcatattccactgctccaggctactactca
tggagaaacacttataatggttcctggttcatacaggcattgtgtgagatgttgcagcgt
cacaagggagagctggagctcatgcagatcatgacccgagtcaaccacaaggtggcgctg
gattttgagtcgtcttccaacctacctggatttagtggcaagaagcagatcccatgtatt
gtctcaatgttgaccaaagacttctactttcctaagtag

KEGG   Monopterus albus (swamp eel): 109972113
Entry
109972113         CDS       T05607                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109972113
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109972113
   04115 p53 signaling pathway
    109972113
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109972113
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109972113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:malb01002]
    109972113
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109972113
Peptidases and inhibitors [BR:malb01002]
 Cysteine peptidases
  Family C14: caspase family
   109972113
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 109972113
NCBI-ProteinID: XP_020476411
LinkDB
Position
Unknown
AA seq 287 aa
MSVNGPGPGPRPGEDATDARRDDGQRAEGSLSTPVAMDVDAKPHLRSFRYSLNFPSKGQC
IIINNKNFDRGTGMNQRNGTDVDAANMMKVFSNLGYKVKIYNDQSVKQMEQVLTAVSKED
HSSSASFVCVLLSHGDEGMIFGTDGSIQLHDLTSLFRGDRCKSLAGKPKLFFIQACRGTE
LDPGIEEDSGNDGTTKIPVEADFLYAYSTAPGYYSWRNTMTGSWFIQSVCDMINAYGKEL
ELQHILVRVNHKVAAEFESISNSPGFHAKKQIPCIVSMLRKEMYFFP
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtcggttaatggacccggacccggacccagacccggagaagacgccacagacgcgagg
cgagacgacggacaacgggcggaggggtctttgtctacccccgttgctatggacgtggat
gctaagccccacttacgcagcttcagatacagcctcaatttccccagcaaaggccagtgc
atcatcatcaacaacaagaactttgacagaggaacaggcatgaatcagcgaaatggtacc
gatgtagatgcagccaacatgatgaaagtgttttctaacttgggttataaagtgaagatt
tacaatgaccagtcagtcaagcagatggagcaggttttaactgctgtgtcaaaggaagac
cacagcagctcggcctcattcgtctgtgttctgttaagtcatggagatgaagggatgatt
tttggtaccgatggctcaatacagcttcatgaccttacatctctttttcgaggcgatcgc
tgcaaatcactggcgggaaagcccaaactcttctttatccaggcctgcagaggcactgaa
cttgatccaggcattgaagaggacagtggaaacgatggcactaccaagatccctgtggag
gcggacttcctctatgcctactccacagccccaggctactactcatggaggaatactatg
acagggtcctggtttatccagtctgtgtgcgatatgatcaatgcatacggaaaagaattg
gagctccagcacatcctggtacgagtgaaccacaaggtggcagcagagtttgagtctatc
tccaactcaccaggctttcatgcaaagaaacaaatcccatgcattgtgtcaatgctgagg
aaagagatgtatttttttccttga

DBGET integrated database retrieval system