KEGG   Monopterus albus (swamp eel): 109957706
Entry
109957706         CDS       T05607                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3 isoform X1
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109957706
   04218 Cellular senescence
    109957706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109957706
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109957706
Membrane trafficking [BR:malb04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    109957706
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109957706
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 109957706
NCBI-ProteinID: XP_020451479
LinkDB
Position
Unknown
AA seq 295 aa
MPSDATMDSCFRTLCMTFVLASFSRRSGAVGPIIRCEPCDAGAQLLCKPLPKVCAERVQE
PGCGCCMTCALSIGQPCGVYTGRCGFGLTCRHQPGETKPLQALLEGRGICGNATSKRLTV
RTTPPVNELPAENSDTQGEERNSTGSDLQPLYSFHRPTEPLKLPLHPFFPSTKSEVLRRE
EQKKTQSFKMEHLPGPLITDQQNFSLETKQEPEYGPCRREIESILSSLKITHILNPRGFR
IPNCDKKGFYKKKQCRPSRGRKRGFCWCVDKYGQPLPAFDGKERKDTQLYNSKSQ
NT seq 888 nt   +upstreamnt  +downstreamnt
atgccatcagacgccacaatggattcctgttttcgcacactttgcatgacttttgtcctg
gcctcgtttagccggaggtcaggtgcggtcggaccgattatcagatgcgagccatgtgat
gctggagcgcaacttttgtgcaaacctttacccaaggtctgcgccgagagagtccaggaa
ccgggctgcggctgctgcatgacttgcgccctgagcatcggccagccttgcggcgtgtac
accggaagatgtggcttcggactgacttgtcggcatcagcccggtgagacgaaacctctg
caggctttgctggaggggcgagggatttgtggaaacgctactagcaaaagactaaccgtc
agaacaactcctccagtcaatgagctgccagcagagaatagtgacactcagggcgaggag
cgcaattccactggctcagatcttcagcccttatacagctttcacagacccacggaaccc
ctgaaacttccgcttcacccctttttcccctctaccaagtcagaagtcctgaggcgtgag
gagcagaagaaaacccagagctttaaaatggagcatctcccgggaccactcatcacagac
caacaaaacttctctctagagaccaaacaggagcctgagtatggtccctgtcggagagag
atcgagagcattctcagcagcctgaagattacacacattctcaaccccagaggctttcgc
ataccaaactgtgacaagaagggcttctataagaaaaagcagtgccgtccatccagaggc
agaaagcgaggtttctgttggtgtgtggacaaatatgggcagcctttgccagcctttgat
ggtaaggagcgaaaagacacacagctctataactccaagagccaatag

KEGG   Monopterus albus (swamp eel): 109961275
Entry
109961275         CDS       T05607                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109961275
   04218 Cellular senescence
    109961275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109961275
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109961275
Membrane trafficking [BR:malb04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    109961275
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109961275
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 109961275
NCBI-ProteinID: XP_020457619
LinkDB
Position
Unknown
AA seq 286 aa
MPGLCVLRLAVALAAFTRLAGTVGPVVRCEPCDAVAHLQCKPPPKDCVEQVREPGCGCCM
TCALGEGQACGVYTARCGSGLTCRHRPGESRPLQALLEGRGVCSSAASKKLNSILIPSQK
QENAGNQVKESCANVTQTMTVLPSVTTVKGGHSRGSTDTRPPLHHKLIQKDQNKKTQSYK
VESVSGGANMDMHNFSLESKRETEYGPCRREMESIINSLKISSVLNPRGFNIPNCDRKGF
YKKKQCRPSKGRRRGYCWCVDKYGQPLPGFDGREWGETQCYNLESK
NT seq 861 nt   +upstreamnt  +downstreamnt
atgcctggtctctgtgtgcttcgtcttgccgtcgcgctagctgcgttcacccggcttgcc
ggcaccgtagggccggtggtccgatgcgagccgtgcgacgcagtggcgcacttgcagtgc
aagcccccgccaaaggactgcgtggagcaggtgagggagcccggttgcggctgctgcatg
acgtgcgctctcggcgagggacaggcgtgtggagtgtacacggcgcgctgcggctccggt
ttgacctgccggcaccgaccgggagagagccgacccctgcaagctttgctggagggccgg
ggagtgtgctccagcgccgcgtccaaaaaactcaacagcattctcataccgtcacagaag
caagagaacgctggaaatcaggtcaaagaaagctgtgccaatgtgacccagacgatgaca
gtgttgcccagtgttacgactgtaaagggtggacacagtcggggctcgacggacaccagg
cctccactgcaccacaaactgatccagaaagatcagaacaagaagactcagagctacaag
gtggaatcagtgtcagggggagccaatatggacatgcacaacttctccctggagagtaag
agggagactgagtatgggccatgtcggcgggagatggagagcattatcaacagtcttaaa
atcagcagtgtgctcaacccgagaggcttcaacatacccaactgtgacagaaagggcttc
tacaagaaaaaacagtgccgtccatccaaaggcaggaggcggggctattgctggtgcgtg
gacaaatacgggcagcctctgcctggcttcgacggcagggagtggggcgagacgcagtgc
tacaacctggagagcaaatga

DBGET integrated database retrieval system