KEGG   Monopterus albus (swamp eel): 109957851
Entry
109957851         CDS       T05607                                 

Gene name
tsc2
Definition
(RefSeq) tuberin isoform X1
  KO
K07207  tuberous sclerosis 2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04140  Autophagy - animal
malb04150  mTOR signaling pathway
malb04218  Cellular senescence
malb04910  Insulin signaling pathway
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    109957851 (tsc2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109957851 (tsc2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109957851 (tsc2)
   04218 Cellular senescence
    109957851 (tsc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109957851 (tsc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109957851 (tsc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109957851 (tsc2)
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109957851 (tsc2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP HEAT
Other DBs
NCBI-GeneID: 109957851
NCBI-ProteinID: XP_020451688
LinkDB
Position
Unknown
AA seq 1872 aa
MNKQPSKESLKDKVKGIFGLGTPRPPSKQSDAKPSEFIITTDIIRELHADCGLSNRVRMM
NHVCDLAKTKRFEEHAVEAVWKAVEDMLTPEQPPEARHAVLQLLRAIIQGQGERLGPLRA
YFFKVIRDYQPCNEDLSDRLEVFKALTENGKDITYLEEDIARFVLLWMDIGLTSDFLHVL
VNLVKFNSCYLDQNVSIMVQKICLLCNRTTSSTDIEVALQVLDAVVCYNCLPSDSLTVFI
ITLCRTVNVKEFCESCWKLMRKVLGTHLGHSAIYTMCRIMEERVYMEDAPLLRGAVFFVG
MALWGAHRLPALKNTPTLVLPSFCKAMLCANEVVSYEIVLSITRLIKKYGKELQVVTWDI
LLGIIDQLLLQIQTISSGELKAIVYELLTTVEELYEQGGYHGSTEKFFSLVEKCADKRPD
ASVLTLISYRAQSIQPAKDGWIQSLHRLMEKFFRNDTRSVIRIKVLHILSFVLSTNRQLY
EDELIEMAVIPHLCGIAEDRDLAVRKQATQLLVDLAEGCNTHHFTGLLDIIERVASRSLV
CSGALEVSERDPMAESPMEDVRTAILGLLEILQSKLYSLPASHASRVYELLISHLQLHYK
NKYCSAIASSIRIQVFEFFLMMRADSLHRLGVPNKDRVMRFSPYCYCDTGEPEKRVSEKK
SAGSTSPPAGSPAPPTAPPPSTVSIRSACLPYSPAFSVILQCLKMETDWKVLKLVLDKLP
CMLQYKVLLLTSPCSLDQLCSTLCCMVTDRLISERLKNTPEGFSRTDVQLAVVPALTAIS
SYHNYLEQLRQRELVQCLEAGFIYRCAKQCVVALTMCTVEMPDIMIKLLPALIVKLTHIS
ATVAMASPMLEFLSTLVRLPHLYANFVAEQYVSVFAISLPYTNPSKFNQYIVSLAHHVIA
MWFIRCRLPFRKDFVQYITKGLRSNALLPFDDGHEQSPFRARSTSLNERPKSLRVAKVTK
AAAAVANSSSSPVKELRDLSAMDAFRSRSISVSEHAVRRMHTSTTTCSLGSADENAVTQA
DEGLKTVHLELTETCLDMMARYVFSNFSALPKRSPIAEFLLAGGPSLTWLVGNKLVTITT
SGGVRTQALLGLDMAERLGGGGGEMTRSDPSLHTRITKEAPAKLESQSSQQHSRATRIRV
RSMSGGHALRAGPAQSLSPLVSPSEGELAAPLSPSCGHTLDGLGPPSSTSTTSSAPPPLK
DNPSLAEFVPMLTQGWAEIFIRRPSGNTSWLMCLENPPSPFSSELGNMPLQELSNVLMAM
EGVKEPPMQTSSAPASTAAPAPTSISEPLTQTHSSIGGKANLIQRCNTDSVVVLEEGSVV
TTAHAPHDWLESEEFEPVTSDPIFMAADKFTKTPPPGTLSRSSSTSSHDDEKSTLEEISE
GGMPIDQPNMGPLTPGSQGPELPFQTHSQSQGHGLNKSSSSPELQTLPEAFTKAAMESET
TLADTLQPRASENKPQGQQPHFEKEKLEGSTRGDINGLGGQSQGSEGPGVVASQGGGMRM
RLECPPAAVQPGTISPSGGHRPRGHTISVSAPSSRRERRTERDLYHSRPGPGTTEKISGL
SPSFVFLQLYHSPFFGNEANKPVLLPKTQVIDRAVKVLDQMPPYDTHKIGVVFVGAGQVN
NEVAILSNEYGSNRYAAFLTGLGKLIHLKDCDPDQIFLGGLDQYGDDGEFTYCWHDDIMQ
AIFHIATLMPNRESDKGCCNKKRHIGNDFVMVVYNDSGEEYKLGTIKGQFNFVEVIIKPL
DYECNLVTLQCRKDLESLVDTTVAKIVSDRNLPLLVRQMALHANMASLVHQYRANPSDAY
ASKWLARLRHIKRIRTRAQEDIQSRSTPGISLTQGHTQQNKSFQQSAQATNPEASGQRKR
LVSTVDDFTDFV
NT seq 5619 nt   +upstreamnt  +downstreamnt
atgaataaacaaccgagcaaggagagtctgaaggacaaggtgaaggggatctttggactg
ggaaccccgcgtccacccagtaaacagagtgacgccaaaccgtccgagtttatcatcacg
actgacatcatcagggagctccacgccgactgcgggctgagcaaccgtgttcgcatgatg
aaccatgtctgcgatctggccaaaacaaaaaggtttgaggagcatgcagtggaggcagta
tggaaagctgtggaggacatgctgactccagaacagccacctgaggccagacatgctgtt
ctgcagctgctgagggccattatacagggacagggggagcgactcggccctctgagagcc
tactttttcaaggtgatcagagactaccagccatgcaatgaagacctctcagatagactg
gaagtcttcaaggccttgacagagaatgggaaggacatcacatacctggaggaggacata
gcacgctttgtcctcctgtggatggacataggtctgacctcagattttcttcatgttctt
gtgaatctggtgaagtttaacagctgctacctggaccaaaatgtctccatcatggtccag
aaaatatgtctcttgtgcaatagaacaacatcctctacagatattgaggtagcactacaa
gtactggatgctgtggtgtgttacaactgcctgccctcagactctctcactgtcttcata
attacactctgtcggacagtcaacgtcaaggagttttgtgaatcttgctggaagttgatg
aggaaggtgctggggactcacctcggccacagtgctatttacaccatgtgccgcatcatg
gaggagagggtgtacatggaggatgcaccattgttgagaggagctgtattctttgtagga
atggcgctgtggggcgcacatagactccctgccctgaaaaacacccccacactggttctt
ccatctttttgcaaggccatgttgtgtgccaatgaggtggtgtcctatgaaatcgtcctc
tccatcaccagactgatcaagaagtatggcaaagagctgcaggtggtcacctgggacata
ctgctgggcatcatagatcagctgctcctgcagatccagacaataagcagtggagagctg
aaggccattgtctatgagctcttgaccacagtagaagagttgtatgagcagggtggttac
cacggctccacagagaagttcttcagtctggtggagaaatgtgctgacaagagacctgat
gcatcagtgctgacgctcatctcgtacagggcccagtctatccagccagccaaggatggc
tggattcagagccttcaccgcctcatggagaaattcttcaggaatgatactcgcagtgtg
ataaggatcaaagtgcttcatatcctgtcctttgttctcagtaccaaccgacagctgtac
gaggatgagctgattgaaatggcggtgatcccccatctttgtgggatagctgaagacagg
gacctggccgtcagaaaacaggccacacagctactggtggacctcgctgagggctgcaat
acacaccacttcaccggcctgctggacatcattgaaagggtggccagtcgctctctggtg
tgttcaggagccctggaggtttccgagagagaccccatggcagagtctcctatggaggat
gtcaggactgctatactgggattgctggaaatcctgcagagcaagctttacagcctacca
gccagccatgccagtcgtgtttatgagctgcttatcagccacctgcagcttcactacaag
aacaagtactgctcagctattgcttccagtattagaatacaggtgtttgagttcttcctg
atgatgcgtgcagactctcttcaccgtcttggagtccccaacaaagacagagtgatgagg
ttcagcccttactgctactgtgacacaggggagccagaaaagcgagttagtgaaaagaag
tcagcaggttcaacatctcctcctgctggcagccctgctccccccactgctcctccccct
tcaacagtctcgatccgctcagcctgcctgccctactcacctgcttttagcgtcatcctg
cagtgcctcaagatggagacagattggaaggtgctgaagctcgttcttgacaagctgcca
tgtatgttgcagtacaaagtgctgctgctgacctcaccatgcagcttggaccagctctgt
tctacactctgctgcatggtgacagatcggctgatatcggagcgcctgaaaaacacccca
gagggtttttctcgcactgatgttcagctggcggtggttcctgccctgacagcgatctcc
tcatatcacaactatctggagcagctgagacagagagagctggttcagtgccttgaggcc
ggcttcatttaccgctgtgccaagcaatgtgtagtggcccttacaatgtgcacagtggag
atgccagacatcatgatcaagctcctccctgctcttattgtcaagctcacccacatctcc
gccactgttgccatggcatctcctatgcttgagttcctctccactctggtgcgcctgccc
catctgtatgccaactttgtagcggagcagtatgtcagtgtgtttgccatctctctaccc
tacactaatccctccaagttcaaccagtacattgtgtccctggctcaccatgtgattgcc
atgtggttcatacgctgcagactccctttccgcaaggactttgttcagtacatcacaaag
ggtttgcgttccaatgccctgctgccgtttgatgacggtcatgagcagagtccgtttcgc
gctcgaagcaccagcctcaatgaaagacccaagagtctgcgggtggcaaaagtgacgaag
gcggcagcagcagtagccaatagcagcagctctccagttaaagagctgagggacctgtca
gccatggacgctttccgctcccgcagcatcagtgtctccgaacatgcggtccgcaggatg
cacacctcaaccaccacctgcagtctgggctccgctgatgaaaatgcggtgactcaggca
gatgaagggctgaagacggtccacctggagctcactgagacttgtttggacatgatggca
cgttatgtgttttccaacttctctgcactgcccaagaggtctcccattgcagagttcctg
ttggcagggggtcccagtctgacctggctcgtgggcaacaagctggtgacgatcacaacc
agcggaggggtcagaacacaagcactgctgggcctggacatggctgaacgtctgggagga
ggaggaggggaaatgacgaggtcagatccctcactacacacccgaataaccaaagaggct
ccagccaaactggagtcacagtcaagccagcaacacagcagagccacacgcatacgggtc
cgctccatgtcaggtggccacgctctacgagctggtcctgctcagagtctcagtcctctg
gtgtccccctcggagggcgagttagccgctccactctctccctcctgcggccacaccttg
gatggtctgggtcctccctcatccacctccaccacctcgtctgctcccccacccctcaaa
gacaaccccagcttggctgagtttgttcccatgttaacacagggctgggcagagattttc
atacggagaccatctggtaacacaagctggttgatgtgtctggagaacccacctagtccc
ttctcctctgagctcggcaacatgccgctgcaggagctctccaatgtcctgatggcgatg
gagggagtgaaggaacctcctatgcagacgtccagtgctcctgccagcaccgctgctccc
gctccaacatccatctcagagcccctaacccaaacacacagcagcattggagggaaggca
aacctgatccagcgctgtaacactgactctgtggtggtgctggaagagggttcggtggtc
accacagcacacgccccacatgattggctagagagtgaggagtttgagccagtgacctct
gatcccatctttatggctgctgacaagtttacaaagacgccgcctcctggaacactcagc
aggtcctcctccacctctagtcatgatgatgaaaagtcgactctggaggaaatcagtgaa
ggagggatgcccattgatcagcccaacatgggacctttgaccccaggcagccagggaccc
gagcttcctttccagacccactctcagtcccagggtcacggacttaacaagtcaagctcc
tccccggagctccagaccttacctgaagccttcaccaaggctgctatggagtctgagact
acactggcagacacattgcaacccagagcatcagagaacaagcctcagggccagcagcct
catttcgagaaagagaaattagagggaagcaccagaggagacattaatggactgggaggg
cagagtcaaggtagtgaaggtccaggtgtagttgcatctcaaggtggaggcatgaggatg
aggttggagtgtccgccagcggcggtgcaacctggaaccatctcccccagtggaggccac
cggccccggggtcacaccatctcagtatcagccccctcatccaggagggagaggaggaca
gagagagacttgtaccacagtcgaccgggaccagggactacagagaagatctctggactg
agccccagcttcgtcttcctccagctgtaccactctcctttctttggtaatgaagccaac
aagccggtgcttctgcccaaaactcaggtgattgaccgtgctgtcaaggttctggaccag
atgcctccttatgacacccataagattggagtggtgtttgttggagctggtcaggttaac
aatgaggttgccatcctgtcaaatgagtatggttcgaaccgttacgctgccttcctcaca
ggcctcggcaaattaatccatctgaaagactgcgaccctgaccagatcttccttggaggg
cttgaccagtatggagatgatggagaattcacctactgctggcacgacgacatcatgcag
gctatcttccacatagccacgctgatgccaaacagggagagtgacaagggctgctgcaac
aaaaagcgtcacattggcaatgatttcgtcatggtggtgtacaacgactctggagaggag
tataaactgggcaccattaagggccagtttaactttgtagaagtcattataaaaccactg
gattatgaatgtaacttggtcaccctccagtgccgcaaagatctggagagcttagtagac
acaacggtggcaaaaatcgtttcggaccgcaaccttccacttttagttagacagatggct
ctgcatgcaaatatggcctctttggtgcatcagtacagagcaaacccctctgatgcttat
gcctccaagtggctagcaaggttacgacacattaagaggatcaggaccagggctcaggaa
gacattcagtctcgctcaactcctggcatctcgctgacacaaggacacactcagcagaac
aagtcgtttcagcagagcgctcaagcgactaatccagaagcctctggccagaggaagagg
ctcgtatcaacagtggatgatttcactgattttgtttga

DBGET integrated database retrieval system