KEGG   Monopterus albus (swamp eel): 109958094
Entry
109958094         CDS       T05607                                 

Definition
(RefSeq) caspase-8-like isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04217  Necroptosis
malb04620  Toll-like receptor signaling pathway
malb04621  NOD-like receptor signaling pathway
malb04622  RIG-I-like receptor signaling pathway
malb04625  C-type lectin receptor signaling pathway
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109958094
   04217 Necroptosis
    109958094
   04115 p53 signaling pathway
    109958094
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109958094
   04621 NOD-like receptor signaling pathway
    109958094
   04622 RIG-I-like receptor signaling pathway
    109958094
   04625 C-type lectin receptor signaling pathway
    109958094
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109958094
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109958094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:malb01002]
    109958094
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     109958094
Peptidases and inhibitors [BR:malb01002]
 Cysteine peptidases
  Family C14: caspase family
   109958094
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 109958094
NCBI-ProteinID: XP_020452108
LinkDB
Position
Unknown
AA seq 539 aa
MEFQRLLLKVEKALCKDEVKALAFLCTDLLGRNPTSVESASALFSRLVDQDHLSPERPHL
LTELLLTIQRNRLVRELGLSECTTMSLISEYRKLLYNLSEEITDEDLKKVKFLLNPTLPR
RRLEDNTTTLEVFLEMEHMDHLSETNLNELEAIIQSVCPVLKEKIAQFKALPVQNSPVGQ
ETGSVYQSPQSLDDERTASCKIPAPRLAECSMFSTNTSVDVVHGGDESEALSHGLNSLST
ETSTHASSQVRSDTLEKSSQESMISETQMFQTTGTTSEGLGAYPMTSAKRGVCLIINNYD
FTKSRNVSLRIREGTATDKDCLHKVFTWLGFETEIYNDYESKEMLSLLQGLSRRDHSRMD
CMACCILSHGKNGSVYGVDGRTVELSELKELFNGINCHSLAEKPKLFFIQACQGTKEQQP
VYIESDAPAESHICSDAVAIESIPSDADFLQAVSTVPHCVSYRERRNGSWFIQSLCQNLI
QMVPWGCDLVSILTKVNADVSQKSDATGKKKQIPQPSFSLRKKVVFPVPKAAPPSMPSF
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggagttccagagattgctgttaaaggtagagaaggccctgtgtaaggatgaggtcaag
gctttagcatttctttgtaccgacctcctgggccgaaatcccacctcagtggaatcagcc
agtgcccttttctctcgtctggtggaccaagaccatctctcacctgagcgaccacatctg
ctgactgagcttctcctcaccatccaacgcaaccgactggtccgtgaactcggtctcagt
gaatgtacaaccatgagcctcatctctgaatacaggaagctactctacaacctgtctgaa
gagatcactgatgaagacttgaaaaaggtgaagttcttgttaaatccgacactcccacga
agaagactggaggacaacactactacattggaagtcttcctggagatggagcacatggac
cacctcagtgaaactaatctaaatgaactggaggccataatccaatcagtctgtcctgtg
ctaaaagaaaagatcgcccagttcaaagcactgccggtacagaacagccctgtgggtcaa
gagacaggctctgtgtaccagtctcctcagtctttagatgatgagaggactgcctcatgc
aaaatcccagcaccgcgactggctgagtgctccatgttttctaccaacacctctgtggat
gtggtacatggtggagatgaaagtgaggccttgtcacatggactgaacagtttaagcact
gaaacaagcacacatgcctcctcacaagtgagaagtgatactttggaaaagtcatcccaa
gaaagcatgatctctgagacacagatgtttcagactacgggcacaacgagtgagggtttg
ggagcatatcccatgacttcagcgaagaggggtgtctgcttgataattaacaactatgac
tttaccaaatctagaaatgtgtctctcagaattcgggaagggactgcgactgataaagat
tgtctgcacaaagtatttacttggctgggctttgagacggagatatacaacgactatgag
agtaaggagatgctgtctctgttgcaggggctcagccgcagagaccacagtcggatggat
tgtatggcctgctgcattctgagccacggcaagaacggaagcgtgtatggtgtggacggc
cgcaccgtcgagctctcagagctgaaggaacttttcaatggaataaattgccactctttg
gcagaaaaacccaagctgtttttcatccaggcctgtcagggcaccaaagagcagcagcct
gtctatattgagtctgatgcccctgcagaaagtcatatttgtagtgatgctgtagcgatc
gagtccatcccatctgatgcagatttcttgcaggcagtgtccactgtgcctcattgtgtc
tcctatagagagaggaggaatggcagctggtttattcagtcattgtgccaaaacctcatc
cagatggtgccatgggggtgtgacctcgtgtctatcctgacaaaggtgaatgcagatgta
agccagaagtctgatgccactggtaaaaagaagcagatccctcagccatccttttcactc
aggaagaaagtggtctttccagtccccaaagccgctcctcccagcatgccatccttttaa

DBGET integrated database retrieval system