KEGG   Monopterus albus (swamp eel): 109958485Help
Entry
109958485         CDS       T05607                                 

Definition
(RefSeq) low-density lipoprotein receptor-like
  KO
K12473  low-density lipoprotein receptor
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109958485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109958485
Membrane trafficking [BR:malb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    109958485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL DUF5050 hEGF EGF TMEM154 PAP_PilO
Motif
Other DBs
NCBI-GeneID: 109958485
NCBI-ProteinID: XP_020452829
LinkDB All DBs
Position
Unknown
AA seq 863 aa AA seqDB search
MTWTRRPLTGGSIFWCLLMLIHCSLHADAAFTCRSTQLKCGNGRCVTRKWICDGTDDCGD
GTDELPETCASKICRESEFNCGPPLNQCIPGSWHCDGKADCDNGADEKNCTAKQCTAGEF
RCASGQCISTAFVCDNDNDCLDGSDEASCPKPTCNSRSFQCNNSVCVPALWRCDGASDCA
DGSDEWPENCAGHQSGKAASCEANEFQCVNGECIHSSWRCDGSADCQDKSDELNCSRSTC
HSDEFQCTDGTCIHGSRQCDKTPDCRDLSDEMGCHIEHVCEGPTQFKCLTGECISMEKVC
DTHKDCRDGSDEPDKECGNNECLNKNGGCSHYCRDLKIGYNCSCPAGYSLKMDQKTCEDI
DECAVPDTCSQICINLPGSYKCDCKEGFVINPATKTCKAESGTVPTLYFTNRHEVRMMTV
DRSEYVRLIPQLKNAVALDMDMPNKMVFWSDLYLKKIYSSNIEVAANSSHHTVVIDSGIE
APEGIAVDWIHGNIYWTDSSLKTISVATTDGSKRKTLVTENLEKPRAITVDPVNNFMYWT
DWGEKAKIERSGLNGADRFALVTDDIMWPNGIALDMVNQRLYWVDSKMHTLSSIDVNGGT
RHRLIFSEDKLSHPLSLTVFEEKVFWTDMDNSAIFSANRLTGMDITELAGDLVQPEGIIL
YHDLKQPIARNWCKESNSMNGGCEFLCLPAPAINKHSPKYTCACPDHMSMGQDMRTCVTG
SVDPTAATKPASPRQPVPTTTTTTTTSTTKTLSTTSSILSKQSTEQPSATAQDRRLEAVP
AEAPLSHPVALYVVVPIMIMSLLVFGAVLLWRHWRIKNTNTIHFDNPVYQKTTEDEVHIC
RNSSEGYVYPQRQMLSMEDMDVA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgacctggacgcggaggccactcaccggagggtccatattttggtgtctgctgatgctg
attcattgttcgcttcacgcagatgcagcgttcacctgcagatccactcagcttaagtgt
ggaaacgggaggtgtgtcacccgcaagtggatctgtgatggaacagacgactgtggcgat
ggaaccgatgagctgcctgaaacctgcgcaagcaaaatctgtcgggagtcagagttcaat
tgtggtcctcccttgaatcagtgtatcccaggaagctggcactgtgatggcaaagctgac
tgtgacaacggggctgatgagaaaaactgcacagccaaacagtgcacagctggagagttt
cgttgcgccagtggtcagtgtatatccaccgctttcgtctgcgacaatgacaacgactgc
ttggatggctcagatgaggcttcctgccccaaacccacttgcaactctcgctccttccag
tgcaacaactccgtgtgtgtgccagccctgtggcgctgcgacggagccagcgactgtgct
gacgggtctgacgagtggccggagaactgtgcaggacaccagtcggggaaggcagcgagc
tgtgaggccaacgagttccagtgtgtgaatggggagtgtatccacagcagctggaggtgt
gatggaagcgcagactgccaggacaaatcagacgagctcaactgcagtcgctccacttgt
cattcagacgagttccagtgtactgacggtacatgtatccatggcagccgtcagtgtgac
aagacgcctgactgcagggacctcagtgatgagatgggctgccacatagaacatgtatgt
gaaggcccaacccagttcaagtgcctcactggagagtgcatcagcatggagaaagtgtgt
gacacacataaagactgcagggatgggtcagatgaacctgacaaagagtgtggcaacaac
gagtgtttgaacaaaaatggcggctgctcccattactgcagggatctgaagattggctac
aactgctcctgccctgctggctacagcctgaagatggaccagaaaacctgtgaagacatt
gatgaatgtgctgtgccggacacttgcagtcagatctgcatcaacctgcctggcagctat
aagtgtgactgtaaagagggctttgtgatcaaccctgcgaccaagacatgcaaggctgaa
tcaggaactgtacccaccctgtactttaccaacagacatgaggtgaggatgatgacggtg
gaccgcagcgagtacgtccgtctgatcccacagctgaaaaatgctgtggctctagacatg
gatatgccaaacaagatggtcttctggtctgacttgtatctgaagaaaatctacagctcc
aacattgaggtggctgctaactcctctcaccacactgtagtaattgacagtgggattgaa
gccccagagggcatcgcagtggactggatccatggcaacatctactggactgacagcagt
ttgaagactatctctgtggcaacgacagatggcagcaagaggaagaccctggttacggaa
aatctggagaagccaagagccatcacagtggacccagtaaataactttatgtactggaca
gactggggtgagaaggctaagatagagaggagcgggttgaatggagcagatcgctttgcc
ttggtaacagacgacattatgtggcccaatggcattgccctagacatggtcaaccagcgt
ctgtactgggtggactcaaagatgcacactctgtcaagcatcgatgtgaatggagggacc
cgccacagactgattttcagtgaagacaagctctcgcaccccctctctctgactgtcttt
gaggagaaagtgttttggacagacatggacaacagtgccatctttagtgctaaccgcctg
acgggaatggacatcaccgagctggcgggggacctggtccaaccagagggcatcatactg
taccatgacctcaagcagcccattgctaggaactggtgcaaggagagtaacagcatgaat
ggaggttgtgagtttctttgcctccctgcccctgcgatcaacaagcactctcctaaatac
acctgtgcctgtcctgaccacatgtccatgggacaagacatgaggacatgtgtgacaggc
tcagttgatcccaccgcagccaccaagccggcttcgcctaggcagcctgtccctacaact
actacaactacaaccaccagcactaccaaaacactctctactacctcttctatcctgtcc
aaacagagcacagagcagccttccgccactgctcaagatagaagattggaagccgtgcct
gcagaggcccctttgtcccaccctgtagctctctacgtcgtggtgccaataatgatcatg
tccttgctggtcttcggagcagtgttgctatggagacactggcgtataaagaacaccaat
accatccactttgacaatccagtgtaccagaaaaccacagaggatgaggtgcacatctgc
aggaacagctctgaaggctacgtttaccctcagaggcaaatgctgagcatggaggacatg
gatgtcgcatga

DBGET integrated database retrieval system