KEGG   Monopterus albus (swamp eel): 109958516Help
Entry
109958516         CDS       T05607                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00020  Citrate cycle (TCA cycle)
malb00190  Oxidative phosphorylation
malb01100  Metabolic pathways
malb01200  Carbon metabolism
Module
malb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
malb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
malb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109958516 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109958516 (sdha)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109958516 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 109958516
NCBI-ProteinID: XP_020452878
LinkDB All DBs
Position
Unknown
AA seq 665 aa AA seqDB search
MASVCTASRLLSKSVLTLSKTKAVPAAAFQSSRNFHFSIYGKKKNAQVSDDISTQYSVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMESDDW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFGGQSLK
YGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTTYFVEYFALDLLMENGECKGVIALCM
EDGSIHRFRAQNTVIATGGYGRTFFSCTSAHTTTGDGNAMVTRAGLPCQDLEFIQFHPTG
IYGAGCLITEGCRGEGGILLNSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGP
EKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVITHSNGEDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAQEHTPGE
KLSPLKPSAGEESVANLDTLRFANGNLRTSEIRLNMQKTMQAHAAVFRTGPVLKEGCDKV
DAIYQTLDDIKTFDRGIVWNTDLVETLELQNLMLNAIQAIHSAEQRKESRGAHAREDYKE
RIDEYDYSKPLQGQEKRPFDQHWRKHTLSYVDPKTGKVTLKYRPVIDSSLDEQDCAHIPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgtctgtactgcgtcgcgactcctttccaagagcgtcctaacgttatctaaa
acaaaagcagtccctgctgctgcatttcagagttccaggaattttcacttctccatctac
ggcaagaagaaaaatgcccaagtgtcagatgatatctctactcagtactcagttgtggat
catgagtttgatgcagtcgtggtaggagctggaggagcaggacttagagcagcttttggc
ctgtcagaggctggctttaacactgcctgcgtcaccaagctcttccccaccaggtctcac
actgttgctgcacagggtggaattaatgcagctctgggaaacatggagagtgatgactgg
cggtggcatttctatgacacagtgaagggatctgactggctgggggaccaggatgctatc
cactatatgacagagcaggctcctgctgctgtagtggagctggagaattttggcatgcca
ttcagccgcactgaagatgggaagatctaccagagagcctttggaggtcagagtctcaag
tacggaaaaggaggccaggctcaccgttgctgctgtgtagcagacaggacaggacactct
ctactgcacacactttatggacggtcgcttcgttatgacaccacttactttgtggagtac
tttgccctggatctactgatggaaaatggagagtgtaaaggagtgattgctctctgcatg
gaggatggatctattcaccgcttccgagcccagaatactgtcattgctactgggggttac
ggaaggacctttttcagctgtacatctgcccacactactacaggagatggaaatgcaatg
gtgaccagagctgggctgccctgccaggatttggagtttatacagttccatcccactggg
atctatggagctggttgcctgatcacagagggttgccgtggtgagggagggatcctgtta
aacagtgagggagagcgtttcatggagcgttatgcacccaatgccaaagacctggcctcc
agagacgtggtgtcccgctccatgaccatagagatcagagagggcaggggtgttgggcca
gagaaggatcatgtgtacctgcagcttcaccacctgcctcctcagcagctggccacacgg
ctgcctggtatctcggagacggccatgatctttgctggagttgacgtcactaaagagccc
atcccagtcctgcccactgttcattacaatatgggtggaatacccacaaactacaaagga
caggtgatcacacacagcaacggagaggacaaggtggttcctggactgtacgcgtgcggc
gaggcagcctgtgccagcgtccatggtgctaacaggctgggcgccaactctctgctggac
ctggtggtgtttggcagagcctgtgccctcaccatcgcacaggaacacacacctggagag
aaactgtcccctctgaagcccagtgcaggggaggagtctgtggccaacctggacacactg
aggtttgccaacgggaacctgagaacctctgagatcaggcttaacatgcagaagaccatg
caggcccacgcagcagtgttccgtaccggccctgttctgaaggaggggtgcgacaaggtg
gatgctatttaccagactctggatgatattaagacctttgacagaggcattgtgtggaac
acagacctggtggaaactttggagctgcagaatctgatgctgaatgccatccaggccatc
cactcggctgagcagagaaaggaaagcaggggagcccacgccagagaggattacaaggaa
cgtattgatgagtacgactactctaagcctctacagggtcaggagaagaggccctttgat
cagcactggaggaaacacactctctcctatgttgaccccaagactggcaaggtgaccctg
aaatatcgccccgttattgactcctctctggatgagcaggactgcgcccacatccctcct
gccatacgctcctactaa

DBGET integrated database retrieval system