KEGG   Monopterus albus (swamp eel): 109958574
Entry
109958574         CDS       T05607                                 

Definition
(RefSeq) G1/S-specific cyclin-E2-like
  KO
K06626  G1/S-specific cyclin-E1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109958574
   04114 Oocyte meiosis
    109958574
   04115 p53 signaling pathway
    109958574
   04218 Cellular senescence
    109958574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109958574
   03036 Chromosome and associated proteins [BR:malb03036]
    109958574
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109958574
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109958574
SSDB
Motif
Pfam: Cyclin_N Cyclin_C BET
Other DBs
NCBI-GeneID: 109958574
NCBI-ProteinID: XP_020452966
LinkDB
Position
Unknown
AA seq 375 aa
MTRQRKDLQKRSENAPGQKSKVTKQSSRKKVQALTRLQCEKNQLVLEGVTEPRIPAKTSK
KEVNIDIDEHDNPTLTLRGSLVHPSPLPHIGWVFSEDVWVKMLNKEHNYRHSKNFMHLHP
RIQPRMRSILLDWLMEVSEAYTLHRQTFYLAQDYFDRFMLTQNNTEKNVLQLIGITCLFV
ASKMEEACPPKVSEMAYVTAGTYYEHEILQMELIILKALSWNLCPETAISWLKLYFQISS
SANSDLLEPQFPQDMFVQMTRLLDLCILNINSLDFQYRVLAASVLCYFLQQETVEKVSGL
SKDIIQPCVTWMAPFAESVDMFGLVTMRSFVQINKDDRYNIQTHTDYMTMLEHVEQKLNS
QFPTSPNSTEKTCSH
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgactagacaaagaaaagatctgcagaaaagatctgaaaatgctccaggacagaaaagc
aaagttactaagcagagcagcagaaaaaaggttcaggccctgacaaggctgcagtgtgag
aagaatcagctggtacttgaaggtgtcactgagcctcgtattcctgccaagacctcaaag
aaggaagttaacatagacattgacgagcacgacaatcctactctcactttgagaggttct
ttggttcatccatcccctctgcctcatattggatgggtcttttctgaagatgtgtgggtg
aagatgctcaacaaggagcacaattacagacacagcaagaactttatgcacttgcatccc
aggatacaacccagaatgagatcgatcctccttgactggttaatggaggtgagtgaggcg
tacacccttcaccgtcagaccttctacctggcacaggactacttcgaccggttcatgttg
acccagaacaacaccgaaaagaatgtgctgcagctcattgggatcacctgtctttttgta
gcatcaaagatggaagaagcctgtcctccaaaggtctcagagatggcctatgtgactgca
gggacctactatgagcatgagatccttcaaatggagttaatcattttgaaggcattgagt
tggaacctttgtcctgaaacagccatttcttggctgaagctttacttccagatttcatcg
agtgccaactctgacctgctggagccacagtttccacaggacatgtttgtccaaatgact
cgtcttttagatctctgtatcctcaacataaactcgctggacttccagtatcgagtgttg
gctgcttcagtcttgtgctatttccttcaacaggaaaccgttgaaaaagtttcaggtctg
tcgaaagacattatccagccgtgtgtcacctggatggctccctttgctgaatcggtggac
atgtttggcctggtgacaatgagaagttttgttcaaataaataaagacgacagatacaac
atccagacacacacagactacatgaccatgctggagcatgttgaacaaaagctgaacagc
cagttccccacttctcccaacagcacagagaaaacctgctcacattga

KEGG   Monopterus albus (swamp eel): 109963397
Entry
109963397         CDS       T05607                                 

Gene name
ccne1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109963397 (ccne1)
   04114 Oocyte meiosis
    109963397 (ccne1)
   04115 p53 signaling pathway
    109963397 (ccne1)
   04218 Cellular senescence
    109963397 (ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109963397 (ccne1)
   03036 Chromosome and associated proteins [BR:malb03036]
    109963397 (ccne1)
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109963397 (ccne1)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109963397 (ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109963397
NCBI-ProteinID: XP_020461560
LinkDB
Position
Unknown
AA seq 407 aa
MRGKREETEPKSVVPEAPKQNPVRPRKRKADVAIYLQDLDEETVEMTKKKQRDCKLGWSP
DAGYTHRWIPTPDPEEDQPVSLINAGFPNYSFNSIFVTPTHCSPLPTLCWASKDVVWRNM
LAKDKTYTRDIHMMEKHPHLQPKMRAVLLDWLMEVSEVYKLHRETYHLAQDYFDRFMATQ
RNVFKSTLQLIGITCLFIAAKIEEMYPPKVYQFAYVTDDACTEDEILSMELIIMKELKWS
LSPQTPISWLNVYMQVAYVKETDELLVPRYPQATFTQIAELLDLCMLDMGCLEFSNGILA
ASSLFHFSSLELVENVSALKGVEVEECARWMVPFAMALRELGGSPMKTFPGVPADDMHNI
QSHAPYLTWLDQAYSYQDEELERHSNCPVPSGVLTPPLSNKKGMLQN
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcgaggcaaacgggaagagacagaaccgaagtctgttgttcccgaggcgcccaagcaa
aacccagttagaccgaggaagaggaaggcagatgttgctatttatttacaagatctggat
gaggagacagtagagatgacaaagaagaagcagcgtgactgtaagttgggctggagtcct
gatgctggttatacacacaggtggatccccacaccggatccggaagaggaccaaccagtt
tccttgataaacgcaggcttccccaactacagctttaacagcatatttgtaacccccaca
cactgttcgccactccccactctgtgctgggccagtaaagatgtggtatggagaaacatg
ttggcgaaggataagacctacaccagggatatccacatgatggagaaacatcctcatctg
cagcccaagatgagggcagttcttctggactggctcatggaggtgagtgaggtgtacaaa
ctacacagggagacgtaccacctcgctcaggattattttgatcgcttcatggccacacag
agaaatgtcttcaaatcaacgctgcaactcataggcatcacctgtctcttcattgctgcc
aaaatcgaggagatgtatcctcccaaggtctaccagtttgcctatgttacagatgacgcc
tgcactgaagatgagattcttagtatggaactcattattatgaaggagctgaagtggagt
ctcagtccacaaactcccatctcctggctcaatgtttacatgcaggtggcctacgtgaaa
gagacagatgaactgcttgtccccagatacccccaggctactttcacacagatagcagag
ttattggacctgtgtatgctagatatgggttgccttgagttttctaatggcatccttgct
gcgtcatctcttttccacttctcctctctggagctggtggaaaacgtctcagctttgaag
ggagtggaggtagaggagtgtgcgaggtggatggtgccatttgccatggcgctgcgggag
ttgggcgggtcacctatgaaaacattcccaggagtccctgcagatgacatgcacaacatc
caatcccatgccccttacctgacctggctggaccaggcctactcttaccaggatgaggaa
ctggagcgccacagtaactgtcctgttccctcaggcgtcctgactccacccctgagcaac
aagaagggaatgctgcagaactaa

KEGG   Monopterus albus (swamp eel): 109970056
Entry
109970056         CDS       T05607                                 

Definition
(RefSeq) G1/S-specific cyclin-E2-like isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109970056
   04114 Oocyte meiosis
    109970056
   04115 p53 signaling pathway
    109970056
   04218 Cellular senescence
    109970056
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109970056
   03036 Chromosome and associated proteins [BR:malb03036]
    109970056
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109970056
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109970056
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109970056
NCBI-ProteinID: XP_020473018
LinkDB
Position
Unknown
AA seq 394 aa
MSRRSSRITLHARDSNTPESLVRVPLRKRKSEPLNKQQPATKKQSYEIQKCWLEDGATPC
VLVETPHKELEPADPSNFKQYRFKNLFIQASPIPRLSWASSDDVWIKMLNKELKYVHDKS
YLQRHPRLQPKMRAILLDWLFEVSEVYSLHRQTAYLAQDYFDRFMLTQKDVGKDYLQLIG
ITALFIASKIEEIYPPKICEFAYVTDGACDMWDIQRTELHILKALDWNLHPETSISWLKL
YAQVEAQKEAENFLVPQFSQETYIQITQLLDLCMMDIGSLDYSYSVLAAAAFCHFFTFDD
LHKVSGLTWDSVDLCVRWMTPFMDTLRSEATPQLKNFPKVKDDDRHNIQTHVAYLDLLRK
AQERQIDSTDCQMSPVAVGSLLTPPSSTEKSANP
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgtccaggcgcagcagtcgcatcacgcttcatgccagagactcaaacacacctgagtcg
cttgtcagagtgccactgaggaaaagaaaatcagagcctttgaataagcaacaacctgct
accaagaaacaaagctatgaaatacagaagtgttggttggaggatggagcgactccatgc
gtactggttgaaactccccacaaagagctggagcccgcagacccatccaacttcaaacag
tacagattcaagaacctcttcatccaggcctcccccattccccgcctcagctgggccagt
tcagatgatgtgtggatcaaaatgctcaacaaggagctgaagtacgtccatgataagagc
tacctgcagcggcaccccaggctgcagcccaagatgagggccattctgctggactggctg
ttcgaggtgagtgaggtttacagcctccaccggcagacggcctacctcgctcaggactac
tttgaccgcttcatgctgacccagaaggatgtcggcaaagactacctgcagctcattggc
atcactgcgctcttcatcgcctccaaaatagaggaaatctaccctcctaaaatctgcgag
tttgcctacgtcacagatggagcctgcgatatgtgggacatccagcgcacagagcttcac
atactgaaggcgttggattggaacctgcatccagagacgtccatctcctggttgaagctg
tatgctcaggtcgaagcccagaaggaagcagagaacttcctggtgccacagttctcacaa
gagacgtacatccagatcacacagctgctggacctgtgtatgatggatatcggctcattg
gactacagctacagtgttctggctgcagctgctttctgccacttcttcacctttgatgac
ctccacaaagtctcaggtctgacgtgggacagcgtggatctctgtgtgcggtggatgaca
cctttcatggacacgctgcgatctgaagccacacctcagctcaagaacttccccaaagtc
aaagacgatgacagacacaacatccagacacacgtggcttatctggacctgctgagaaaa
gctcaggagcgtcaaatcgacagcactgactgtcagatgtcaccagtggccgtgggatca
ctcctgactccacccagcagcacagagaaatcagccaatccctga

DBGET integrated database retrieval system