KEGG   Monopterus albus (swamp eel): 109958999
Entry
109958999         CDS       T05607                                 

Definition
(RefSeq) uncharacterized protein LOC109958999
  KO
K08774  transforming growth factor, alpha
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109958999
   04012 ErbB signaling pathway
    109958999
SSDB
Motif
Pfam: EGF Laminin_EGF hEGF
Other DBs
NCBI-GeneID: 109958999
NCBI-ProteinID: XP_020453677
LinkDB
Position
Unknown
AA seq 246 aa
MTRIFWDTIFLISGSLFTFGAGPNNSTVIEAGISIETNPSAAPSASTSSPTTTRSTTTTN
IPTVKSSLFTYGGQTNSTFTDTGISIDTNSSAAPYMSPNSSAPTSRGSAPTTVTVATTTN
IPPVKKFMAAAVRSHFDDCPRSHRHFCLHGTCRFLILEETPACVCHPGFVGMRCEHADLL
AVVATNHRQQTVATMLVLCVSGSVLIMVLCTLSHCWWRQDCRRRSHAHHYVPEKDGALHH
PSESVV
NT seq 741 nt   +upstreamnt  +downstreamnt
atgactcggattttctgggatacaatttttctcataagcgggtccctctttacatttgga
gcagggccaaataattcaacagttattgaagctggcatttccattgaaacaaacccaagt
gctgctccaagcgcctccacaagcagccccacgaccacccgcagcacaactactaccaac
atccctacagttaaaagttccctctttacatatggaggacagaccaattcaacatttact
gatactggaatttccattgatacaaattcctctgctgctccatacatgtcaccaaacagt
tctgcacctacaagcagaggaagtgccccgaccacagtgactgtggctactacaactaac
atccccccagttaaaaagttcatggctgcagctgttcggtctcattttgatgactgtcca
cgctcccaccgccatttctgcttacatggtacatgtcgcttcctaatattggaggagact
cctgcatgtgtatgtcacccaggctttgtcgggatgaggtgtgagcatgcagacctgctg
gctgtggtagcaactaatcacagacaacagactgttgccacaatgctggtgttgtgtgtg
agtggaagtgtcctgatcatggtgttgtgtacactttcacattgttggtggagacaggac
tgtcgcaggcggagtcatgcacaccactacgtcccagagaaggatggagctttgcaccat
ccatctgagagcgtggtttga

DBGET integrated database retrieval system