KEGG   Monopterus albus (swamp eel): 109959030
Entry
109959030         CDS       T05607                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
malb  Monopterus albus (swamp eel)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 109959030
NCBI-ProteinID: XP_020453744
LinkDB
Position
Unknown
AA seq 390 aa
MREVETKRSLSPHFCDDGGNQVVTDTMSWGEFIELRDMRVSREQVALTGTPAPCQPPRLE
RTNALRISPGKVPDLLSRVGIIRMLSSTQDPQFTEGRGEGHNFQPCSHTQPTWCDLCGDF
IWGLYKQSLRCVNCRFTCHYRCRALIQLDCSWDRGSVSDQTDVVEHTIETDTNVDEQIES
GKPELTTTDIQQKVKEYNAQINSNLFMNMNKDGSYTGFIKVQFKLVRPVSVPSPKKGGHD
GGRRGSKVKRRTSFYLPKDASKHLHISSRTSAREVIEALLKKFTVVDNPGKFALFERSER
HDQVYVRKLSDDERPLCLRLCTGPNEKVLSFVLKENETGEVNWHAFSMPELKNFLRILQR
EEEEHIKQIVQRYALARTKMQDALAGSTPG
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgagagaagtcgagacgaagcggtcgctttctccccacttctgcgatgatggaggaaac
caggttgtgactgacacaatgtcttggggggagttcatcgagctacgtgacatgcgggtg
agcagagagcaggtagcgctgaccggcacacctgcaccctgccagcctccacgcctggag
agaaccaatgccctgaggatcagcccgggaaaggtcccagacctgctgagtcgggtgggc
attatcagaatgctgagcagcacacaggacccacagttcactgagggaaggggagaagga
cacaacttccaaccgtgcagccacactcagcccacatggtgcgacctgtgtggagacttc
atctggggactttacaaacagagcctgcggtgtgtcaattgtagattcacatgccactac
cgctgtcgtgccctcatccagctggactgcagctgggaccgaggctctgtgtctgaccaa
acggatgttgtggagcacaccatagaaacggacacaaatgtggatgaacaaattgaatct
ggtaagccagagttgacaacgacagatattcagcagaaggtcaaggagtacaatgctcaa
atcaacagcaatctgttcatgaacatgaacaaggatggctcctacactggcttcataaag
gtgcagttcaagctagtgcgacctgtgtcagttccatctccaaaaaaaggaggtcatgat
gggggtaggaggggtagcaaagtaaagcgtcgcacctctttttacctgccaaaggatgca
tccaagcacctgcatataagctcgcgcacttcagctcgcgaggtgatcgaggctttgttg
aaaaagtttacagttgtggacaatcctggcaagtttgctttgtttgagcgcagcgagcgt
catgaccaggtttatgttcgcaagctgtctgatgatgagcgtcccctctgtctgcgtctg
tgcactgggcccaatgagaaagtccttagttttgtactcaaagagaacgaaaccggagaa
gtcaattggcatgccttctccatgcccgagttaaagaacttcctgcgcattctgcagcgt
gaagaagaggaacacatcaagcagatagtgcagcggtacgctctggcccgcactaagatg
caggatgctctggctggctcaacccctggctga

DBGET integrated database retrieval system