KEGG   Monopterus albus (swamp eel): 109959219Help
Entry
109959219         CDS       T05607                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn] isoform X1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109959219 (sod1)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109959219 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109959219
NCBI-ProteinID: XP_020454068
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVLKAVCVLKGDGETSGTVHFEQQNESAPVKVTGEIKGLVPGEHGFHVHAFGDNTNGCIS
AGPHFNPEKKNHGGPKDKDRHVGDLGNVTAGQDHVAKIDITDEMISLVGRNSILGRTMVI
HEKVDDLGKGGNEESLKTGNAGGRLACGVIGIAE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaagctgtttgcgtgctgaaaggagatggagagacctccgggactgttcat
tttgagcagcagaatgaatcagcccctgtgaaggttacaggagaaatcaaaggccttgta
cctggtgagcatggttttcatgtccatgcttttggagacaacacaaatggttgcatcagt
gcaggacctcacttcaatccagagaaaaagaatcatggtggtcctaaggataaagacagg
catgttggagacttgggcaatgttactgcaggacaagatcatgttgccaagatagacatc
acggatgaaatgatcagccttgttggccgcaactccatccttggccgaactatggtgatc
catgaaaaggttgatgacctgggaaaaggaggcaatgaagagagcctaaagactggcaac
gctggtgggcgtctggcttgtggagtcattggcatcgccgagtaa

DBGET integrated database retrieval system