KEGG   Monopterus albus (swamp eel): 109959574
Entry
109959574         CDS       T05607                                 

Gene name
perp
Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109959574 (perp)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 DUF3367 Tetraspanin Claudin_2 Amastin Clc-like
Other DBs
NCBI-GeneID: 109959574
NCBI-ProteinID: XP_020454712
LinkDB
Position
Unknown
AA seq 184 aa
MFRCGIAYPRCRWIVPLLLLFAIIFDIIAIAATSGWVEDEDAKSDYASMWERCRGKEKWT
CTSLMEFSWAQAVAALMIIGLLILIVAFIISCVALCCTLNMTLLPLIAILLIIVVILQVI
ALIIYPVKFNEMIFEGNYYYTWAYGFGWGATILCIGCAVLFCCLPRYEDELTGLAKTKYI
YSSA
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtttcgctgtgggatcgcctacccccgatgcaggtggatcgtgcccctgctactgctc
ttcgccatcatctttgacattattgccatcgccgccacctcaggatgggtcgaggacgaa
gacgcaaagtctgactacgccagtatgtgggagcggtgccgaggcaaggagaagtggacc
tgtacgtcgctaatggagttctcttgggcccaggcagtggctgctctgatgatcattggc
ctcctcatcctcatcgttgccttcatcatctcctgtgtggctctgtgctgcacgctcaac
atgaccctcctgcccctcatagcaatactgctgattattgttgtgatcctccaggtcatc
gctctgatcatctatcccgtcaagttcaatgagatgatctttgagggcaactactactac
acctgggcctatggctttggctggggcgccaccatcctctgcattggctgcgccgtcctc
ttctgctgcctgccacgttatgaggatgagctgaccggtctggccaagaccaaatacatc
tattcctctgcttaa

DBGET integrated database retrieval system