KEGG   Monopterus albus (swamp eel): 109959603
Entry
109959603         CDS       T05607                                 

Definition
(RefSeq) protein phosphatase 1D-like isoform X1
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109959603
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109959603
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109959603
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    109959603
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 109959603
NCBI-ProteinID: XP_020454763
LinkDB
Position
Unknown
AA seq 562 aa
MDEAIIFRMSAFSEQGGRKYMEDILEIRIEYEPTPSTVEDYPKSQIHGGQGKAESETIIQ
TEHVTHDHNVTGKSGPAYAVWLENISNNSAPVSHQIDARKSVAFFAVFDGHGGREAAHFA
RENLWCLLKRQRGFWSKDHSEVCAALRKGFIACHHAMWKELPEWPKTITGLPSTSGTTAS
VIVIRGVHMYVAHVGDSAVVVGVKENDSDITLQALEVTQDHKPELPKEKERIERLGGSIM
KKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARSLGDLWSYDFYSGEFVVSPEPDT
TVMTLDPKRHRYIILGSDGLWNMMPSKNAVNMCYSHDKMVGPKGMSCARRLGCTALLFWK
ERMLRADNTTVIVLALQERGGPPIPMHRDEIIIDMAAGINHVPYPGTSYNTCEVQRQSDA
VNAPSPFKESFTSLEQAIGLYEAAFCATAQLSPNVDSVRATLPPSDGSVNVFEKQDSTTQ
MDCATSAPPLKRCRLSTDIPPEPPAPSCRVGRSSSKGFPQKTPPSKVRSKQSRRSRAQNR
ERSSSEESSILSQHHNAALCVC
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggacgaggcaataatatttcgtatgagtgcattttccgagcaaggagggaggaaatac
atggaggatattctcgagataagaatcgagtacgagccgacaccgtcgacagtcgaagat
tatccaaagtcgcagatacatggaggacagggaaaagcagagagtgaaactatcatacag
actgaacatgtaacacacgatcataacgttactggcaaatctggcccagcttatgcggtg
tggctagaaaatatatcaaacaacagtgcaccggtatcacaccaaatagacgctcggaag
tcagtggcgtttttcgctgtttttgatggtcacgggggtcgagaagcggcacattttgca
agggaaaacctctggtgtttgttgaaaaggcagcgggggttttggtcgaaagatcatagt
gaagtgtgtgctgctcttcggaaagggttcatcgcctgtcaccatgcaatgtggaaagag
ctgccggagtggccaaagactattaccggcctgcccagtacatcaggcactacagccagt
gtgattgtgatccgcggagttcacatgtatgttgcccatgtaggggattcagcagtagtg
gttggagtgaaagaaaatgactctgatatcacactccaggcacttgaagtaacacaagac
cataaacctgaacttcctaaagaaaaagaaaggattgagcgactaggtggcagcatcatg
aagaaatctggagtgaatcgtgttgtgtggaagaggcccagattaacccataacggccct
gtgaggaggagtacagtcattgaccagatccctttcctggctgtggcccgatcccttggc
gatctctggagctatgatttctacagtggggaatttgtggtttctccagagcctgacact
actgtgatgaccctcgaccccaaacgacatcgttacatcatcctcggcagtgatggactg
tggaatatgatgccatccaagaatgcagttaatatgtgttacagccatgacaaaatggtg
ggaccaaaaggaatgtcttgtgcccgccggctgggatgcactgccctgctgttttggaaa
gagcgcatgctccgtgcagacaacacaacagttattgtcttggctctgcaggagcgcgga
ggcccacctatccctatgcatcgagatgagattatcattgatatggctgcaggaatcaat
catgtgccatacccaggaacttcttataacacctgtgaggtccaaaggcagagtgatgcg
gtgaatgctccctccccattcaaagagagtttcacatctctggagcaggctatagggcta
tatgaagcagcgttctgtgccacagcacagctctcacctaatgttgactctgtgagggcc
acactgcccccttcagatggttcagtgaatgtttttgaaaaacaagactccacaacccaa
atggactgtgctacttctgctcctccattaaaaaggtgtcgcctgtctacagacatcccc
cctgaacctccagctcctagctgtcgggttggccggtcctccagcaaaggttttcctcag
aagacacctcctagcaaagtacggagtaaacagtcccgtcgatctcgtgctcaaaacaga
gaaaggagctcctctgaggaaagcagtatcctatcgcaacaccacaacgctgccttgtgt
gtgtgctga

KEGG   Monopterus albus (swamp eel): 109969731
Entry
109969731         CDS       T05607                                 

Gene name
ppm1d
Definition
(RefSeq) protein phosphatase 1D
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109969731 (ppm1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109969731 (ppm1d)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109969731 (ppm1d)
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    109969731 (ppm1d)
SSDB
Motif
Pfam: PP2C PP2C_2 Apelin
Other DBs
NCBI-GeneID: 109969731
NCBI-ProteinID: XP_020472481
LinkDB
Position
Unknown
AA seq 551 aa
MENALLMRVSVFADQGGRKYMEDVTEVIVEPEPGEDDPTSDEPVESIGGDCTVTSVAVDT
HPDRTDEIVGSRQVSDETFEHIQRDNQSTSVETSLHGGQPSMASRPRRSVAFFAVFDGHG
GPEAAQFARDYLWEFMKKQRGFWSDCDQEVCSAIRKGFVACHHAMWKKLPEWPKTLTGLP
STSGTTASVVVIRGNRMYVAHVGDSAVVLGVQDDPSVPFIRAMEVTQDHKPELPRERERI
EGLGGSVIKKSGVNRVVWKRPRLSHNGPVRRSTVIDQIPFLAVARALGDLWSYDFYSGEF
VVSPEPDTSVVTLDLRKHRYIILGSDGLWNMVPPQEAISICQNNDKAMAPFGVSSARQLV
SHALLRWRQRMLRADNTSAIVIALQEPGTSQDTLHHEEALLDLAKLSQCPLTSISRADTP
LLQRPPEEDSPSGVCELLPALERRDGLSGSNSLYHMDLSDLFTLTPLCPHSSTELPSRSS
PTNRTVGSRMPNNKRTSDESSLPSSGQLAKKARRRTANRLPLVQHNAEKKQESSNVSPIL
QQHNKTTVCVY
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggaaaacgcattactgatgcgagtgagcgtgtttgccgaccaaggaggcaggaaatac
atggaagatgtgaccgaggtaatagttgagccagaaccgggagaagatgatccaacatcg
gatgagccagtggagagcattgggggagactgtactgtcacatctgtagctgtggacacg
catccagaccggactgatgaaatcgtggggtctcggcaggtttcagatgaaacctttgaa
catatacaaagggacaaccaaagtacatcagtggaaacatctttacatggaggtcagccg
agcatggcgagtcgtccccgccgttctgtggcgtttttcgccgtgtttgatggccacgga
ggtcccgaggctgcgcagtttgcacgagactatttgtgggagttcatgaagaaacagcgt
ggattttggtcagactgtgaccaggaggtctgctccgctatacgcaaaggttttgtagca
tgccaccacgctatgtggaaaaagctacctgaatggccaaagacacttaccggcctccct
agcacatcaggcaccacagccagtgtagtggtcattcgaggaaatcgtatgtatgtggcc
catgttggtgattctgctgtagttctaggggtccaggatgacccctcagtcccattcata
agagcaatggaagtcacacaagaccacaaacctgaactacccagagagagggagcgtatt
gaaggtctgggaggcagtgtgattaagaaatctggggtgaaccgagtcgtctggaagagg
ccgaggctgagtcacaatggccctgtccgtaggagcacagtcattgaccagataccattc
ttggcagtagcccgagctctaggcgatctgtggagctacgatttctacagtggagagttt
gtggtttctcctgagccagacaccagtgtagtgacccttgacctcagaaaacaccgctac
atcattctgggcagtgatggtctgtggaacatggtcccacctcaggaggccatctccatt
tgtcagaacaatgacaaggcgatggcaccgtttggggtatcgagcgcccggcagctggtc
agtcatgctctgctgcggtggcgccagcgaatgttgcgcgctgacaacaccagtgccatt
gtaatcgccctccaggagcctggaacctcccaggacaccctacaccatgaggaggcactg
cttgaccttgccaagttgtcccagtgtcctcttacgtctatatctcgtgctgacactcct
ctcctccagcggcctccagaggaagactctccctctggtgtgtgcgagcttcttcctgcc
ctggagcgacgggatggactatcaggaagcaacagcctgtaccacatggatctgtctgac
ctgtttacactgactccactgtgtccacacagtagtactgagctgcccagtcggtccagt
cccactaacaggacagttggcagcaggatgccaaacaacaaaagaacaagtgatgaatca
tcattaccatcctcaggccagctagctaagaaagcccgccgcaggactgccaacaggctg
cccctggtccagcacaatgccgagaagaaacaggagtccagtaacgtctcccccattctc
cagcagcacaataagaccacagtgtgtgtgtactga

DBGET integrated database retrieval system