KEGG   Monopterus albus (swamp eel): 109959661
Entry
109959661         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mothers against decapentaplegic homolog 2-like
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04144  Endocytosis
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109959661
   04371 Apelin signaling pathway
    109959661
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109959661
  09143 Cell growth and death
   04110 Cell cycle
    109959661
   04218 Cellular senescence
    109959661
SSDB
Motif
Pfam: MH2 MH1 IRF-3 BNR_4
Other DBs
NCBI-GeneID: 109959661
NCBI-ProteinID: XP_020454849
LinkDB
Position
Unknown
AA seq 483 aa
MSSILPFTPPVVKRLLGWKKSTSSPGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNCNTKCVTIPSNCSEIWGLSTPNTIEQWDTSGLYSYPDQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELRAIESCEYAFHLKKDEVCINPYHYQRVETPVLPPVLV
PRHSEILPELPPLDDYTHSIPENTNFPAGIEPPNNYIPETPPPGYISEDGEASDQQMNQS
MDTGSPAELSPSTLSPVNHNMDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRXXXXXXXXXXXVRLYSNESKSILSVFSGRGVRLYYIGGE
VFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEA
VYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSARCS
SMS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtcctccattttgccgtttacccctcctgtggtgaagaggctgcttggctggaagaag
tcgaccagcagcccaggaggagcgggtggtggagagcagaatgggcaagaggagaaatgg
tgtgagaaggctgtgaagagcttagtgaagaagctaaagaagacaggccagctggatgag
ctggagaaagctatcaccacacagaactgcaacaccaagtgtgtcaccattccgagcaat
tgctctgaaatatggggactgagtacaccaaatacgatagaacagtgggatacatcaggc
ctatacagctaccctgaccaaaccagatccctggatggccgtctgcaggtctcgcacagg
aagggacttccccatgttatctactgccgcttgtggcgatggccggaccttcacagtcac
cacgagctgcgcgccatcgagtcctgcgagtacgccttccacctcaagaaggacgaggtc
tgcatcaatccctaccattatcagagggtggagaccccagtgctgcctcctgttcttgtg
ccaagacactcagaaatcctgccagagttgccacctctggatgactacactcattccata
cctgagaacacaaactttcccgcaggaattgaacctccaaacaactatataccagaaaca
cctccaccaggctacatcagtgaggatggggaggccagtgatcaacagatgaatcaaagt
atggacacaggttctccggcagagctctcccccagcacgctgtctcctgtcaatcacaac
atggacctgcagccagtgacttactcagagccagccttttggtgctctatagcgtactat
gagctgaaccagcgtgtgggggaaacgttccatgcctcacagccctcgctgacagtggat
gggttcacagatccatcaaactctgagcgtttctgcctgggcctgctgtctaatgtcaac
aggannnnnnnnnnnnnnnnnnnnnnnnnnnnataggtacggctttacagcaatgaatcc
aaatcaattctgtctgtgttttcaggaagaggagttagactctactacattgggggggaa
gtatttgcggagtgcctgagtgatagcgccatctttgtccagagcccaaactgcaaccag
cggtatggctggcatccagcaacggtgtgtaaaattcccccaggttgtaatttaaaaatc
ttcaacaaccaggaatttgcagcgctcctagctcagtcagtcaaccaaggctttgaagct
gtataccagctcaccaggatgtgcaccatccgtatgagctttgtcaaaggctggggagcc
gagtacaggcgacagactgtcacaagcactccttgctggattgagctgcatttgaatggt
cccctgcagtggctggacaaggttctgacccagatgggttccccgtctgcacgttgctcc
agtatgtcctaa

KEGG   Monopterus albus (swamp eel): 109963341
Entry
109963341         CDS       T05607                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04144  Endocytosis
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
malb04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109963341
   04350 TGF-beta signaling pathway
    109963341
   04371 Apelin signaling pathway
    109963341
   04068 FoxO signaling pathway
    109963341
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109963341
  09143 Cell growth and death
   04110 Cell cycle
    109963341
   04218 Cellular senescence
    109963341
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109963341
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 109963341
NCBI-ProteinID: XP_020461436
LinkDB
Position
Unknown
AA seq 425 aa
MSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNIN
TKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHHELRAVELCEYAFHTKKDEVC
VNPYHYQRVETPVLPPVLVPRHTEIPSEFPPLDDYSHSIPENTNFPAGIEPQINYIPETP
PPGYLSEDGETSDHQMTHSMDTSSPNLSPNPVSPTHSNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcaattttgcctttcactccccccattgtcaaaagacttttgggctggaagaaggga
gagcagaacggccaggaggagaaatggtgtgaaaaagcagtgaaaagtctggtgaaaaag
ctgaagaagacgggacagctggacgaactggagaaagccatcaccacccagaatatcaac
acaaaatgcatcactataccaaggtctctagatggccggctgcaggtgtcccacaggaaa
ggtctgccccacgtcatctactgccgtctgtggcgctggcccgacctacagtcccaccat
gaactgcgggcggtggagttgtgcgagtatgccttccacacgaagaaggacgaagtgtgt
gtcaacccgtatcactaccaaagagtagagacaccagtactcccaccagtgctggtgccc
agacacacagaaattcccagtgagttcccaccgctggacgattacagccattcaatccct
gaaaacaccaacttccctgctggcattgagccccagatcaactacataccagaaacgcca
ccaccaggctacctcagtgaggatggagagaccagtgatcatcagatgacccacagcatg
gacacaagctcccctaacctgtctcccaaccctgtctcacccacgcacagcaacttggac
cttcagccagtgacgtactgtgagccagctttctggtgctcaatttcatactatgagctg
aaccagcgagtaggagagactttccatgcctcacagccctcgcttacagtagatggattc
accgacccctccaactcggagcgtttttgcctgggcttgttgtccaacgtcaaccgcaat
gcagctgtggagttaacacgcagacacattggccgtggtgtgcgactgtattacatcgga
ggagaagtgtttgctgaatgtctcagtgacagcgccatctttgtccagagccccaactgt
aatcagcgctacggatggcaccctgccacagtttgcaagatccctccaggatgtaacttg
aagatcttcaacaaccaggagtttgctgccctgctggcccagtcagtcaaccaggggttt
gaggctgtgtaccagctcaccaggatgtgcaccatccgcatgagcttcgtcaagggctgg
ggcgctgagtacaggcgacagacggtgaccagcaccccctgctggattgagctgcacctg
aatggccccctgcagtggctcgacaaggtgcttacacaaatgggctcccccagcatccgc
tgctccagcgtctcttag

KEGG   Monopterus albus (swamp eel): 109971207
Entry
109971207         CDS       T05607                                 

Gene name
smad3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04144  Endocytosis
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
malb04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109971207 (smad3)
   04350 TGF-beta signaling pathway
    109971207 (smad3)
   04371 Apelin signaling pathway
    109971207 (smad3)
   04068 FoxO signaling pathway
    109971207 (smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109971207 (smad3)
  09143 Cell growth and death
   04110 Cell cycle
    109971207 (smad3)
   04218 Cellular senescence
    109971207 (smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109971207 (smad3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 109971207
NCBI-ProteinID: XP_020474964
LinkDB
Position
Unknown
AA seq 425 aa
MSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLEELEKAITTQNVN
TKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHHELRAVDHCEFAFHTKKDEVC
INPYHYQRVETPILPPVLVPRHMDIPAEFSSLDDCSPSIPENTNFPAGIEPQSNYIPETP
PPGYLSEDGETNDHQLNHSMETGSPSLSPNPVSPTNSNLDLQPVTYCESAFWCSISYYEL
NQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNSAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFATLLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIN
CSSMS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtctatattaccgttcactcctccaatcgtgaagaggctccttggctggaagaaggga
gagcagaacgggcaagaggagaaatggtgcgaaaaggctgtgaaaagtcttgtgaagaag
ttgaaaaagacgggacagttggaagagttggaaaaggccatcacaacacagaatgtcaac
acaaaatgcataaccatacccaggtctttagatgggcgtctccaggtctcccacagaaaa
ggtcttcctcatgtgatctactgccgcttgtggcgctggccagacctgcagtcccatcat
gaactgagagctgttgaccactgtgaatttgccttccacaccaagaaggatgaagtgtgc
atcaacccctaccactaccagagggtggagacgccaattttgcctcctgtcttagtacca
cgacatatggatatccccgcagagttctcatcgctggatgactgcagtccatccattcct
gagaacactaacttccctgctggtattgagccccagagtaactatattcccgaaactccc
ccaccagggtatctgagtgaggatggtgagacaaatgatcaccaactcaaccacagcatg
gagacaggttcacctagcctatcgcccaatcctgtgtcacccacaaacagtaatcttgac
ttacaacctgtgacatactgcgagtctgccttctggtgctctatctcctactatgaactg
aatcaacgtgtaggagagaccttccatgcttcccagccatccctcacagtcgacggattc
acagacccctctaactctgagcgcttctgtctgggcttgctgtcaaatgtaaatcgcaat
tcagcagtagagctcacacggagacatataggacgaggcgtgaggttgtattacattggg
ggagaagtgtttgcagagtgtctcagtgacagtgccatctttgtccagagtcccaactgc
aaccaacgctacggttggcatcctgccactgtctgcaaaatccctccaggctgcaaccta
aagatcttcaacaaccaggagtttgctaccctgcttgcccagtcagtcaaccagggcttt
gaggctgtctaccagctcaccaggatgtgtaccattcgcatgagttttgtcaagggctgg
ggggctgagtacaggcgtcagacagtgaccagcaccccctgctggattgagctacatctc
aatggccctttgcagtggctggacaaggtcctcacccaaatgggctctcccagcatcaac
tgctctagtatgtcctag

DBGET integrated database retrieval system