KEGG   Monopterus albus (swamp eel): 109959755
Entry
109959755         CDS       T05607                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04060  Cytokine-cytokine receptor interaction
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04217  Necroptosis
malb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109959755
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109959755
   04217 Necroptosis
    109959755
   04115 p53 signaling pathway
    109959755
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109959755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:malb04050]
    109959755
   04090 CD molecules [BR:malb04090]
    109959755
Cytokine receptors [BR:malb04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109959755
CD molecules [BR:malb04090]
 Proteins
  109959755
SSDB
Motif
Pfam: TNFR_c6 Death EphA2_TM ECSCR DUF4834 GRA6 Peptidase_M56
Other DBs
NCBI-GeneID: 109959755
NCBI-ProteinID: XP_020455018
LinkDB
Position
Unknown
AA seq 407 aa
MTEFQPLCLMVFFMLTLSLKPMGAFPRPGLDVGGRMLLHVSCGANYEYLHDNICCLNCPA
GTRVKSPCTKAGQKGTCEECDYGTYTEHDNGLNQCFKCTKCRSDQEIARQCTSTQNTECQ
CKPGRFCAPEQACEVCKKCLRCGKDEQVVRNCTSTTDTECKKIQASSSSASGIIAVIVLV
VIVAAVIIGAVFYWRMRRCRAAGSQSSQPDGMKAGHHHTDSCSTQERRNGENRRHSSSNW
QLVRPKSSAGMEDEREVLCKSLNSSASNSQHSLTGLPSSAFPATLAQASPVVPRQPDRRE
YEQLPKLIPVSGEESLRKCFEYFEEMDVSYYKRFFRHLGLTDNMIKSKEHLQYEDRIHEL
LNIWVEKVGRDASLNDLLKALFDLNQRRTAEMARESAVRNGHYIPES
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacagagttccagccattatgcctaatggtttttttcatgctgaccttgtccctcaaa
cccatgggtgcgtttccacggcctggccttgacgttggaggcaggatgctgctgcatgtc
tcttgcggagccaactatgagtacctgcatgacaacatctgctgtttaaactgtccagct
ggtacacgtgtgaaatcaccctgcaccaaagcaggacagaaggggacatgtgaggaatgt
gactatgggacatacactgagcacgacaatggtctgaatcagtgtttcaagtgcacaaag
tgtcgctcagatcaggaaattgcgaggcagtgtacttccactcaaaacactgaatgtcag
tgcaagccagggagattttgtgctcctgaacaagcatgtgaagtgtgcaagaagtgttta
aggtgtggaaaagatgagcaggttgtgaggaactgcacctcgaccaccgacacagagtgc
aagaaaatccaggccagctctagttcagcctcaggaataattgcagtgattgtgctagta
gtgattgttgctgctgtgatcatcggggcagtattttactggaggatgaggagatgcaga
gcagcaggctctcagagtagtcagcctgatgggatgaaagctggacatcatcacactgac
agctgttccacccaggaaaggaggaatggagaaaatcgaaggcacagtagctcaaactgg
caactggtgagacccaaatcctcagctggtatggaggatgagcgtgaagtgctgtgcaaa
agcctcaacagctcagccagtaactcgcagcatagtctaaccggcttgccctcctctgcc
ttccctgcaaccctcgcccaagccagtcccgtggtccccaggcagcccgacaggagggaa
tatgagcagcttcccaagcttattcctgtgagtggtgaagagtctttgaggaaatgcttt
gagtattttgaagaaatggatgtcagctactacaagagattcttccgtcaccttggcctc
actgacaatatgatcaaaagcaaggaacaccttcaatatgaagacaggatccatgagtta
ctgaatatatgggtggagaaagtgggcagagatgccagcttaaatgatctgctgaaagca
ctgtttgatttgaatcagaggcgaacagctgaaatggccagggagagtgctgttagaaat
ggccattacatccctgagtcttaa

KEGG   Monopterus albus (swamp eel): 109969775
Entry
109969775         CDS       T05607                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04060  Cytokine-cytokine receptor interaction
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04217  Necroptosis
malb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109969775
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109969775
   04217 Necroptosis
    109969775
   04115 p53 signaling pathway
    109969775
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109969775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:malb04050]
    109969775
   04090 CD molecules [BR:malb04090]
    109969775
Cytokine receptors [BR:malb04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109969775
CD molecules [BR:malb04090]
 Proteins
  109969775
SSDB
Motif
Pfam: TNFR_c6 Death Flp1_like
Other DBs
NCBI-GeneID: 109969775
NCBI-ProteinID: XP_020472572
LinkDB
Position
Unknown
AA seq 448 aa
MSFKPLVGKLYVVAALFIVLVCHADELPASQWSGDEYRNHTVRQQRACVENEQYLHQGLC
CINCQAGTFVDKPCERDQEQGTCRPCDHGKTYTEHPNGMDRCLQCTPCRSDETETAPCTT
TTDARCQCKQGTFCVPDQACEVCKRCAKCKPGEEEVKKCTSISNTVCQKRDPSPTGPSPA
LPTPTPPSASDIWNPIYITLGAIIIIIIIILAGLAVRFKRQLCERPCLKSHCDSSEIVKI
PIDESGATAEERQNNQNAGLEGEEVRPESRPLLQETQTEMTKASPAREDEDRGLGDSLPN
TTNSSQTSLSALPTAASSGNTPHQSPAAFRLPPADVDDPLRHRLVPLQGSEKSLKKSFDL
FDEYLDVRIHNKFFRLIGVSDNHIRIAENGPTVDKVYELLKNWMQKEGLKADINDLLKAL
LSLDQLRSAESIASAALQKGYYKHAGTP
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagcttcaaaccgctggtcggcaaactttacgtggtggcagctctcttcatcgtgctg
gtttgtcatgcagacgaactgccagcatctcagtggtccggcgatgaatacaggaatcac
acggttcgacaacagagagcctgtgttgagaacgaacagtacctccaccaggggctctgc
tgcatcaattgccaggctggaacatttgtggataaaccctgtgaaagagaccaagaacaa
gggacgtgtcgtccctgtgatcatggaaagacctacacagagcaccccaatgggatggac
cgctgtctgcagtgcaccccctgtcgctcagatgagactgaaactgcgccctgcaccaca
acgaccgacgctaggtgccagtgcaaacaggggactttctgtgtgccagatcaggcctgt
gaggtctgcaaacgctgtgccaagtgcaaaccaggggaggaagaggtgaagaagtgcacc
tccatttctaacactgtgtgtcaaaagcgggacccgtcccccactgggccatctccggcc
cttcccacgccgacgccgccttctgcatcagacatctggaatcctatatacatcaccctg
ggtgccatcatcatcatcatcatcatcatccttgctggactggctgtgcggttcaaacgg
cagctgtgtgaaagaccatgtctaaagagccactgtgactccagtgaaatagtgaagatt
cctattgatgagagtggagccacggcagaggagcggcagaacaatcagaacgcaggcctg
gagggagaggaggtccgccccgagtcccggcccctgctgcaggagacccagactgagatg
accaaggcctcccctgcccgtgaagacgaggaccgaggcctaggggacagtttgcccaac
accactaactcatctcagactagcctgtcagccctgcccacagcggcttcctctggtaac
accccccaccagagccccgctgccttcaggctgccgcctgcagacgtggatgatcctctg
agacatcgactggtgccactgcaagggtcagaaaaatccctgaagaagagctttgatttg
tttgatgagtacctggacgtgcggatccataacaagttcttcagactgattggagtcagt
gacaaccacattcggattgcagagaacggccccaccgttgacaaagtgtatgaactgctg
aagaactggatgcagaaggagggactaaaagcagacatcaacgacctgttaaaagctttg
ctaagtctggaccagctgcgctcggctgagagcatcgcctctgcagccctgcagaagggc
tactacaagcacgcaggcactccctga

DBGET integrated database retrieval system