KEGG   Monopterus albus (swamp eel): 109959862
Entry
109959862         CDS       T05607                                 

Gene name
apaf1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109959862 (apaf1)
   04115 p53 signaling pathway
    109959862 (apaf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109959862 (apaf1)
SSDB
Motif
Pfam: WD40 APAF1_C NB-ARC ANAPC4_WD40 CARD Ge1_WD40 CARD_2 WD40_like eIF2A Utp8 AAA_22 AAA_16 NACHT AAA_18
Other DBs
NCBI-GeneID: 109959862
NCBI-ProteinID: XP_020455227
LinkDB
Position
Unknown
AA seq 1262 aa
MRKLSSLEMALEEGARSCLLRFRHNLEQDIQPSHLMDHMIADGVMTVDEEDRITAQRTRK
DRAVTLLELLLRKDNYAYTSFYNALVKEGYDDLANLLHDNLPDVHKNPSDGSTSYVQTVL
SEGGVPQRPVVFVSRPELVNRVREKLYRLQKEAGWVTVFGMAGSGKSVLAAEAVRHHELI
EECFPGGVHWLSIGQLDKPDLLVKIQLLCFRLEQSLDSQSLHRTPSSLDEAKERLRFLML
RRYPRSLLILDDIWDSTVLKAFDIHCRILLTTRNRSLTDSVSGAKYEVEVESGLDENKAL
EILALYTKTKPKALPEEARSIVRECKGSPLVVSLIGALLKEKPNRWHYYLGQLQQKQFKR
IRKSSSYDYDALDQAMAASIEVLPDEHQELYKDLTVIEKDIKVPAKVLSVLWDLEPEEVE
DILEEFANKSLLFVDSHNKPYLYYLHDLQLDFLVEQNRTELESLHTKVVRQYQQHYRDGP
PTSGDEECLYWIRFLPYHMAKANLSQELYSLMFSLDWVNIKAQIMGPAHLINDYVEYGPI
LDKENSEVRSQFQEFLSLNGHQLEQRPFPDVVQLALSQPCTSEVYRQALQQAQDRASTGK
LYFDWLNKSSVESLSRLVIHPQQGSIYSACFSHDGAKIASCGASKTLKVFKSTSGEKLME
IPAHDDEVLCCAFSPDDHLLATCSSDRKVKVWNVERAMLLRVFEEEHEEQVNHCQFTNTT
RRLLLVTCSNDKYLNVKVWNLNKPSSQNTLFGHFEPVNHCCFSPDDSYVSTSSNDGTVKL
FQVSSANMWKTINVRNMFAESDEEVLVKCSTWTADSKRIICAARNAVLVFDVDTSDMLLE
IRTSRLSMVQYCHACPTSNLLAIAFSNYAVELWDLEANKKMADCSGHLSWVQRVQFSPDG
SQLLSCSDDQTVRLWETKRVHTSKAIHLKRDSDVLFNDEDIIVSAADNCNRLQVRNGRTG
SVLFQSEEKSSRIRCTCMCRQPSVVALGQEDGTVQVLEVPSGKLLATLLGHTKTVLHCQF
SHNGQILITSSEDTTIRLWRWQSGVCKVLQGHKEQVRCFCLLSNSPANTRLLSWSFDGTV
KVWDIESGEKLQDIEAHRGAVLSCHVSPDGCFLATTSADKTAKLWQCESWQCVHTLSGHQ
GCVRSCRFSWDSLRLATGDDNGEIRLWSVKDGSLLKICSREGKDGMDSLHGGWVTDLHFS
PDNSLLVSTGGYIKWWDVEKGEALQTFYPKGSTLKRIHVSSSFSTFVTIDSIGILYVLQR
VV
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgaggaagctgtcttctttggagatggcgctggaggaaggagcacggagctgtctgttg
cgctttcgccataatctagagcaagacatccagccttcccacctaatggaccacatgatc
gctgatggtgtgatgactgtcgatgaggaggataggatcacggctcagcgtaccaggaag
gatcgggctgtgactttgctggagctgctgctgagaaaggacaactatgcttacacctcc
ttttacaatgcacttgtcaaggagggatatgatgatttggccaatctgctccatgataat
ctacctgatgtacataagaacccctctgatggctccacatcttacgttcagacagtgctg
agtgaaggtggtgtaccacagaggccagtggtgtttgtcagccgaccagagctggtgaac
cgggtcagggagaaactttaccgtctgcagaaagaggctggctgggtcactgtgtttgga
atggctggctcgggcaaatctgtcctggctgcagaggctgtcagacaccatgaactcatt
gaagagtgttttcccggaggtgtccactggctgtccattggtcagctggacaaaccggac
ctgctggtgaagatccagttattgtgttttcgtctggagcagagcctggattcccagtcc
cttcatcgaaccccaagctctctagatgaagccaaggagcgcctgcgcttcctcatgcta
cgcagatatccgagatctctgctgattctagatgacatctgggacagtacagtgctgaag
gcatttgatatccactgtcggatacttttgaccaccagaaatagaagccttactgattca
gttagtggtgctaaatatgaggtggaggtggagagtggtctagatgaaaacaaagcattg
gaaatccttgctctgtacacaaaaactaaaccaaaggcacttcctgaggaggctcgcagc
attgtaagagaatgtaaaggctctcctctggtggtgtccttgattggggctctgctcaaa
gagaaacccaaccgttggcattactacctcggccagctgcagcagaagcagtttaagcgg
ataagaaagtcatcatcctacgattatgatgccctagatcaggccatggctgcaagtatt
gaggtcctgcctgatgaacatcaagagctttacaaggaccttactgtaatagaaaaggac
atcaaagtccctgctaaggtactgtctgttctgtgggacctggagccggaggaggtggag
gacattcttgaggagtttgccaataagtctctgctctttgtggacagtcacaataaacca
tacctatactacctccatgacctccagctggacttcctggtggagcagaaccgtactgag
ctagaaagcctccacactaaggtggtgcgtcagtaccagcagcactacagagacggccct
cccacgtcaggagatgaggaatgtctctattggatcagattcctgccctaccacatggcc
aaagccaatctctctcaagagctctactccctcatgttctctttggattgggtcaacatc
aaggcccagataatgggtccagcccacctcatcaatgactatgtggagtatggacccatt
ctggacaaagagaacagtgaagtgcgcagtcagttccaggagtttttgtctctgaacggc
caccagctggagcagcgtccttttcctgatgtggtgcaactggcactgtctcagccatgc
acctctgaggtctacaggcaggctctgcagcaggcacaggaccgggccagcacagggaaa
ctctactttgactggctgaataagagcagtgtagagagtctgtcccgtctggtgatccac
ccccagcagggctccatctactctgcctgcttctctcatgatggagccaagatcgcctcc
tgtggagccagcaagactctgaaggtgtttaaaagcacctcaggtgagaagctcatggag
atcccggcccatgatgacgaggttctctgctgtgccttctcccctgacgaccatcttcta
gcaacctgctctagtgacaggaaagtaaaggtgtggaatgtagagcgagccatgctgctg
agggtctttgaggaggagcatgaagagcaggtcaaccactgtcagtttaccaacacgaca
cggcgcctcctgctggtcacctgctccaatgacaaatatctgaacgtcaaggtgtggaac
ctcaacaagccatcctcccagaacaccctgtttggccactttgagccagtcaaccactgc
tgcttctcccctgatgacagctatgtgtcaacgtcctccaacgatggcactgtaaagcta
tttcaagtatcatctgccaacatgtggaagacaatcaatgtgaggaacatgtttgcagag
agcgatgaagaggtgcttgtcaagtgcagcacctggacggcagacagcaaacgcatcatt
tgtgctgccaggaatgctgttttggtgtttgatgtggacacatcagacatgttgttggag
atcaggaccagtcgtctgagcatggtgcaatactgccacgcctgtcctaccagtaatctg
ctggctattgccttctcaaactatgctgtggagctgtgggacttagaagccaataagaag
atggctgactgcagtggtcacttaagctgggtccagcgtgtccagttctctcctgatggc
tcacagctgctctcctgctctgacgaccagactgtcaggttatgggagactaagagggtt
cacacctccaaagccatccatctgaagagagactctgatgtcctcttcaatgatgaagat
atcatcgtgtcagctgcagacaactgcaacaggctgcaggtgcgcaacggcagaacagga
tcggtgctgtttcagtcagaagagaagtcatccaggatccgttgtacctgtatgtgcaga
cagccctctgtggtggctctgggccaagaggatggcactgtacaggtgttggaggtgcct
tctggaaagcttctggccactctgctaggtcatacgaaaacagtgctacactgccagttc
agccacaatggtcaaatactcatcacatcttcagaggacaccaccataaggttgtggagg
tggcagtcaggggtgtgtaaagtactccagggtcacaaggaacaggtcagatgcttctgt
ctgctctccaactcaccagccaacacaagactactgtcctggtctttcgacggcactgtc
aaggtgtgggacatagaaagtggagagaagctgcaggacatcgaggctcaccggggagca
gttctgtcctgtcatgtctcaccagacggatgctttctcgccaccacttctgctgacaag
actgctaagttgtggcagtgtgagtcctggcagtgtgtccacacactcagtggtcatcaa
ggctgtgtccgaagctgccggttctcctgggacagcctgcgccttgcaactggagatgat
aacggcgagatccggctctggagtgtcaaggacgggtctctgctgaagatctgttcccgg
gagggtaaagatggcatggactcactccacggaggttgggtgaccgaccttcacttctcc
ccagacaactcccttcttgtctcgactggcggctacatcaagtggtgggatgtggagaaa
ggagaggccctgcagaccttctatccaaaggggagcactttgaaaaggatccatgtgtca
tccagcttctccaccttcgtcaccattgacagcattggcattctttacgtcctccagagg
gtggtgtga

DBGET integrated database retrieval system