KEGG   Monopterus albus (swamp eel): 109959866
Entry
109959866         CDS       T05607                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04020  Calcium signaling pathway
malb04260  Cardiac muscle contraction
malb04261  Adrenergic signaling in cardiomyocytes
malb04270  Vascular smooth muscle contraction
malb04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109959866
   04020 Calcium signaling pathway
    109959866
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109959866
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109959866
   04261 Adrenergic signaling in cardiomyocytes
    109959866
   04270 Vascular smooth muscle contraction
    109959866
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:malb04040]
    109959866
Ion channels [BR:malb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109959866
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF1406 Rer1
Other DBs
NCBI-GeneID: 109959866
NCBI-ProteinID: XP_020455235
LinkDB
Position
Unknown
AA seq 2314 aa
MVNESKNMYIPEDTLENHQGSDYSPPPPLPQLPHPSLTNEHSGSGSRGNHGGGGGGLNHG
VGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAASGGGSELGSGGGGPISTASSTQR
KRQHYSSKPKKQTTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVA
LAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDF
IIVVVGLFSAILEQATKVEGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNS
IIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCIYEHLGTIAEEKPAPCAPDGAY
GRHCKLNGTECKMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELP
WVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWI
TQAEDIDPENEEEGLDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTRLANRISKSK
FSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHKQPQWLTDVQDIANK
VLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRC
VRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE
TRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYI
LLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARLASPEKCQDNEKPPLEEKKEKIE
LKSITSDGETNTATKINMDDYCGDENEEKNPYPANDYIGDDDDDEPEMPVGPRPRPLSDI
QLKEKAVPMPEARAFFIFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKN
DSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSG
IQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFAC
IGVQLFKGKFSFCTDSSKQTQAECRGSYIMYKDGDVGKPERAQRSWENSDFNFDDVLQGM
MALFAVSTFEGWPGLLYRAIDSHAEDVGPVYNYRVVISIFFIIYIIIIAFFMMNIFVGFV
IVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLM
FTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNV
FDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSSSSSHPPVVRPMVRSNGNLVRLP
ASSTIPPSLHPSIPPSATSSMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDHTQINRNNNFQTFPQAVLLLFR
CATGEAWQEIMLACSPNRPCEKGSTSDNSTSSEDCGSQFAIIYFVSFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKI
WKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQ
AGLRTLHDIGPEIRRAISGDLTVEEELDKGLKEPVSAASEDDIFRVKRTGGLFGNHVNYY
NQSDGRSSFPQSFTTQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSYSSSGSNANI
NNANNTGMAGVPTQGIIRFPSPSISTVDGHTEQPLTPILLPRSAWCFPPKSSDSSESRLP
IIRRGEGSTEETYDESYGDDREYHEEDHSLSSDMLVYHDETCKQLTPMEGGEELEDRRGG
GWQSPRRVFLCPTSLGRRSSFHLECLRRQSRPDVSQKTAVPLHLVHHQALAVAGLSPLLR
RSHSPTLFSRLCSTPPASPTAHGSDASCQQVPSLRLEGSSSHEKLNTSLPSVNCGPWYGD
NNRRPSSSPIPSTLVSSHRAPRPVSLTVPSVLRKDSSLTSHGSAGSLVEAVLISEGLGRF
AQDPSFIEATKAELADACDMTIEEMEHAANNILNGSTTANIASSSPSTSQHSPNGNLLPF
HTTAATHRDRVVSLSPSEGGGEAGGSRGSVHEPSSVEERQELLICGRGREEEEEEEEGGV
RKEEHHRSSVVAGGARQRNSGLLEDEDLECVTSL
NT seq 6945 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacatcccggaggatacccttgagaaccatcaaggc
tccgactactctccccctccccccctgcctcagcttcctcaccccagcctgaccaacgag
cacagtggcagtggtagccgtggcaaccatggtggaggaggtggtgggcttaaccatggg
gtgggcgtggtgggcctggctccagagcacattcccacaccgggggcggctttgagctgg
caggcagccatcgatgctgcacggcaggcaaagatgatgggcaatgctgcgtcgggtgga
gggtcggagcttgggtcaggaggcggcgggcccatctccacagccagctccacacaaagg
aagagacaacactatagctctaagcccaagaagcagacgacgacgacagcaacaaggccg
ccacgggccctactgtgtctcacgctcaagaaccccatccgcagggcctgcatcagcatt
gtggagtggaaaccatttgagatcatcatcctgatgacaattttcgccaactgtgtggcc
ttagctgtctacatccccttccctgaggatgattcaaatgccaccaactctaacctagag
cgtgtggagtatctgttcctcatcattttcacagtggaggcattcctaaaggtaatagcc
tacggcctgctcttccaccccaacgcctacttgaggaacggctggaatctgctggatttc
atcattgtagtcgtagggttattcagtgcaatcttagagcaggccaccaaggtggaagga
gccactcctattggtgggaaggcagcaggcttcgatgtcaaagctctgagggcattcaga
gtactcagacccctcagactggtctctggagtgcccagtttacaggtagtgttgaactcc
ataatcaaagccatggttcctctgctccatatcgccctgctggtcctcttcgtcatcatc
atttatgccatcattggcctggagctcttcatgggcaagatgcacaagacctgcatttat
gagcatttaggcaccattgcggaggaaaagccagcaccgtgcgcacctgatggagcttac
ggtcgacactgtaaactgaatggaacagagtgcaaaatgggatgggagggcccaaatgac
ggcatcaccaactttgacaactttgcttttgccatgttaacggtgttccagtgtataacc
atggagggctggacggatgtgctatactggatgcaggatgctatgggctatgagctgcca
tgggtctattttgtctctcttgtcatcttcggctcgtttttcgttctcaatctcgttctg
ggggtgttgagcggagagttttccaaagagagggaaaaggccaaggcacgtggtgacttc
cagaaactcagagaaaaacaacaactggaggaggacctcaagggctatttagactggatc
acccaggctgaagatattgacccagagaatgaagaggagggcttggatgatgacaaaccc
agaaacctgagcatgccagccagtgagaatgagtcagtcaacacagacaacgcccccggg
ggagacgtggagggggagacctgctgtacccggctagcaaataggatctccaaatccaag
ttcagtcgctactctcggcggtggaacaggctgtgtaggagaaagtgtcgggcggccgtc
aaatcgcaggttttctattggctggtcatcttcctggttttcctcaacactctgaccatt
gcctctgaacatcacaagcaacctcagtggttaactgatgtacaagacatagccaataag
gtgctgctagcactcttcactggtgagatgctgttgaagatgtacagtctgggcctgcag
gcatactttgtttcactgtttaatcgcttcgacagcttcgtagtttgtggaggaattctt
gagaccattctagtggaaaccaagatcatgtctcctctcggcatctctgtgttacgttgt
gtgcggttgctacgaatcttcaaaataaccagatactggaactcgctgtccaacctggtg
gcctccctgctaaactctgttcgttccattgcatccctgttgctcctgctgttcctcttc
atcatcatcttctccctgctcggcatgcagctctttggggggaaattcaacttcgatgag
acccgtcgcagcaccttcgacaactttccccagtctctgctcactgtgtttcagatccta
acaggagaggactggaactctgtgatgtatgatggcatcatggcatatggtggaccgtcc
ttccctggcatgctggtctgcatctacttcatcatcctcttcatctgtggaaactatatc
ctactgaatgtcttcttggccattgctgtagacaatctcgcagatgctgagagcctgaca
tctgcccagaaagaagaagaagaggagaaggagaggaaaaaactggccaggttggccagt
ccagagaagtgtcaggacaatgagaagccacctctggaggagaagaaggagaagatagag
ctcaagtccatcacctctgatggagagaccaacactgctactaagatcaacatggatgac
tactgtggagatgagaatgaagagaagaatccatatcctgcaaatgactacataggagat
gatgatgatgacgagccagagatgccagtgggcccgaggccacggccactctccgacatt
cagctaaaggagaaggctgttcccatgcctgaggctcgtgctttcttcatcttcagccat
accaacaaattcagggttctgtgccataagatcgtcaaccataacatttttaccaacctc
atcctcttcttcatcctgctcagcagcatcagtctggcagcggaggacccagtcaagaat
gactccttcagaaaccagatccttggctatgcagatcatgtcttcactggactcttcacc
atagagatcattctgaagatgacagcctatggagccttcctccataaaggttcattctgt
agaaactatttcaacatcctggacctggtggtggttagtgtgtccctcatctcctctgga
atacagtccagtgcgattaatgtggtgaagatcctgagagttctgcgagtgctcagaccg
ctgagggccatcaacagagccaagggactaaagcatgttgtgcagtgtgtttttgtggcc
atcaggaccattggcaacattgtcattgtcaccacattactccagttcatgttcgcatgt
attggagtacaactctttaagggcaagttctccttctgtactgacagctctaaacaaact
caggcagagtgcaggggttcgtacatcatgtataaggatggtgatgtggggaagcctgaa
agagcccagagatcatgggagaacagtgactttaactttgatgatgttctacaaggcatg
atggctctatttgctgtgtctacctttgagggctggccagggttactataccgagccata
gattctcatgctgaggacgtcgggcccgtctacaactatcgcgtggtcatctccatcttc
ttcatcatctacatcatcatcatcgccttcttcatgatgaacatctttgtcggtttcgtc
attgtcacattccaggagcaaggagagcaagaatataaaaactgtgagctggacaagaac
cagcgtcagtgtgtggagtatgccttgaaggcccgtccgttgcgtcgctacatccccaag
aacccctaccagtacaaggtgtggtatgtggtcaactccacatactttgagtacctgatg
ttcacactcatccttctgaacaccatctgtctggccatgcagcatcatggacagaccaaa
aatttcaatgatgccatgaacatcctcaacatgctcttcacaggactcttcactgtggag
atgatccttaaactgatcgccttcaaacccagggggtactttagtgatccctggaatgtg
tttgatttcctcatcgtaattggcagcataatagacgtcattctcagtgagatcaaccca
gctgactcctcctcgtcttcgtcctcctcctcttcgtcctcctcctcctcctcttcctcc
tctcacccccctgtggtaaggccaatggtacgctccaacggtaacctcgtccgcctccct
gcctcctccaccattcctccatccctccatccttccatccctccttctgctacatcatcc
atgggactgcagaactctgaagagaacgccaggatctccatcaccttcttcagactgttc
cgcgtgatgaggctggtgaagctgctgtctcgcggggaagggattcggaccctgctgtgg
accttcatcaaatccttccaagctctgccctatgtagctctgcttatagtgatgctattc
ttcatatacgctgtcatcggcatgcagatgtttggtaagatagcactgcgggaccacaca
cagatcaacaggaacaacaatttccagacattccctcaggcagtgctgctgctcttcaga
tgtgcaacaggtgaggcatggcaggagatcatgcttgcatgctctcccaatcggccgtgt
gagaaaggatcaaccagtgacaacagcacatccagcgaggactgtggcagccagtttgcc
atcatttactttgtcagcttctacatgctctgtgcctttctgatcatcaacctgtttgtg
gctgtcatcatggacaactttgactacctgacgcgtgactggtcaatcctggggccacat
catcttgatgaattcaagaggatctgggctgaatatgacccagaagctaagggcaggatc
aagcaccttgatgtggtgactctgctccggagaatccagcctccacttggctttggcaag
ctttgtccccacagggtggcctgcaagcgtctggtgtcgatgaacatgcctctgaacagt
gatgggacagtgatgttcaacgccacactgtttgctctggtcagaaccgcactcaggatc
aagacggaaggtaatctggagcaagccaatgaagaacttcgggcaatagtgaagaagatc
tggaagagaaccagcatgaagctcttagatcaagtagtgccccctgctggtgacgatgag
gtaacagttgggaagttctacgctaccttcctcattcaagaatatttccgcaagtttaag
aagaggaaagaacaagggctggtggccaaggtgccccccaaaactgccctctctctgcag
gcgggcctgcggacattgcatgacattggtccagaaattcggagggccatctctggagac
ctgactgtagaagaggagctggacaaaggtctgaaggagcctgtgtcagctgcatctgag
gatgatatcttcagggtaaagcgcacgggtgggttgtttggcaatcacgtcaactactac
aaccaaagtgatggccgcagttctttcccacagtccttcactacccaacgtcccttgcat
atcagtcaaaagggctcaccttgtgaaggcgagagcccatcacatgaaaagctcatggac
tcgaccactttcaccccttcttcctactcctactcttcatcaggctccaatgccaacatc
aacaatgccaacaacactggcatggccggggtgccaacccagggcatcattcgattccca
agcccatccataagcactgtggatgggcacacagaacagccactcacccccatcctgctc
ccaagatctgcatggtgctttcctccaaaaagctcggactctagtgaaagccgtctgcca
atcatccgaagaggggaggggtcaacagaggagacgtatgatgagagctatggcgatgat
agggagtaccacgaggaggaccactcgctctcctctgacatgcttgtgtatcatgatgaa
acatgtaagcagctgactcccatggagggaggagaggagttagaagacagaagaggagga
gggtggcaatctcccaggagagtcttcctctgccccacttctctggggcggagatcttcc
ttccatcttgagtgtctcaggagacaatcaaggccagacgtctcacagaagacggctgta
cccttacaccttgtacatcatcaggctctagcagtggcagggttgagtcctctgctcaga
aggagtcactcacctaccctcttcagccggctatgctctacacctccagccagtcccaca
gctcatgggagtgatgcttcctgccagcaagtgccctctctgaggctagagggctccagc
tcccatgaaaagcttaatactagcttgccctctgtcaactgtgggccctggtacggtgac
aataacagaaggcccagttctagtcccatccccagcacactggtgtccagtcatagagcg
ccacggccggtgtcgctcacagtaccatcagtgctgagaaaagactctagcttgacgtct
catggcagcgcaggcagtttggtggaggcagtgctaatatctgaggggctgggtcgtttc
gcccaggacccatcattcattgaggcaaccaaagccgagttggctgatgcttgcgacatg
actatcgaggagatggagcacgctgccaacaacattctcaatggcagcaccactgcaaac
atcgcatctagcagcccctccacctcccagcacagccctaatggcaacctcctccccttc
cacacaacagcagcaacacacagggaccgagtggtcagcttgagtcccagtgagggcggg
ggagaggctggaggaagtagaggctcagtccatgagccatcctctgtggaggagcggcaa
gagctgttaatatgtgggagaggacgagaggaggaggaggaggaggaggagggaggagtg
agaaaggaggagcatcacagaagctcagttgtggctggaggagcgcggcagaggaacagc
gggctgttggaagatgaggatttggagtgtgtgacaagtttgtag

DBGET integrated database retrieval system