KEGG   Monopterus albus (swamp eel): 109959948
Entry
109959948         CDS       T05607                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109959948 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109959948 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:malb03310]
    109959948 (nr3c1)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109959948 (nr3c1)
Nuclear receptors [BR:malb03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109959948 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR DUF5407
Other DBs
NCBI-GeneID: 109959948
NCBI-ProteinID: XP_020455373
LinkDB
Position
Unknown
AA seq 805 aa
MDQGGLKHNGNRDDSLTFGNTGAGVGRDTGDTAGSLLQSTMHLPSPGSLPQTTVTPNGQG
GTKVQGEFGGLFESSQHLSLCEGSDTKEGKINRIQKQLQQQQQDISIFIMEDNLPLLNQS
VCDLDQMSTSVISTSDTSVLGNLPLPDLFSQQIKQEGNFSLDKDLGTYSGHTGTGPCDLD
GNSSHLIEDTEIWQDLDLSSSLPEISDFELDSEVAHLDNILQENSGVIGPDSGLLKETKS
LVGNGGNCTSVNGSDQQQHPIHHQQQQHILQHQQYQLQHQQAASLLSSVMIKEEKDPESS
FIHLRTPGVVKLEKEDRAGFCQSQCLQSSMSPLQVGGPMSTPVGVGAAPGYPYRASLSSR
VGPQDQKPFGMYSNLAAAGDSWAKGNRYGESPGIQRADDGLPSTSALAPFSVNFSSLSPR
TGETSSSVAPGQSKPSGQTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNT
DGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLKMKMPRSPGSSEP
ASHMPVAVIPRCTPQLVPTMLSVLKAIEPGIIYSGYDGTIPDTSSRLMSTLNKLGGQQVI
SAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGSMLCFAPDLVINKE
RMKLPFMTDQCEQMLRICHEFVRLQVSYEEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMT
YIKELGKAIVKREENATQNWQRFYQLTKLLDSMQAMVEGLLQICFYTFVNKTLSVEFPEM
LAEIISNQIPKFKDGSVKALLFHQK
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggatcagggtggtctgaagcacaatggtaatcgagacgacagcttgacctttggaaat
acaggagccggagtaggcagggacacaggtgacacagctggttcacttctgcagtctaca
atgcacctgcccagtcctgggtctctgccccagaccacagtgaccccaaatggacagggt
ggaaccaaagtccagggggagtttggaggcctctttgagtcctctcagcatctttccctg
tgtgaggggtcagacacgaaggagggcaaaatcaacagaattcagaagcaactacagcaa
caacaacaggatattagtatattcatcatggaggacaacttgcccttgttgaatcagagt
gtctgtgatcttgaccagatgtccacctctgtcatcagcacctcagacacctctgtcttg
ggcaatctccctttacctgaccttttctcccaacaaatcaagcaggaggggaatttttct
ctggataaggacttgggaacttacagtggacacacaggcactggcccatgtgatttggat
ggcaacagcagccacttaatcgaggatactgagatttggcaagacctggacctttctagc
tcgctgccagaaatcagtgattttgagctggattcagaagtggcacacttggataacatc
ctccaagagaacagtggtgttattggtcctgacagtggtttgctgaaagaaaccaagtct
ctggtgggtaacggaggaaactgtaccagtgtgaatggcagtgaccagcagcagcacccc
atacatcatcagcagcagcagcacatactgcagcaccagcaatatcagcttcaacatcag
caagctgcatcccttctctccagtgttatgatcaaggaagagaaagatccagaaagttct
ttcatccacctccgcactcctggtgtggtcaaactggagaaggaggaccgtgctggtttc
tgccagtcccagtgtctccagagcagcatgagccctctacaagtaggaggccctatgtcc
acacctgtgggtgttggtgcagcaccgggttacccctacagagccagcctgtcctccaga
gtgggcccacaggaccagaagccttttggcatgtactcaaacctggctgcagcgggggac
agctgggccaaggggaacagatatggagagtcacctgggatacagagggctgatgatggg
ctcccctcaacctcagctttggcacctttttctgtcaacttctccagcttgtctcccaga
acaggagagaccagcagttctgtggcaccaggccagtccaagcccagtgggcaaacccat
aagatctgtttggtgtgttcggacgaggcctcgggatgccactacggcgttgtgacctgt
ggcagttgtaaggtgttcttcaagagggccgtcgaaggatggagagcacgacaaaacact
gatggccagcacaactacctgtgtgcagggaggaatgactgcatcattgataagatccgc
aggaagaactgtccagcctgccgcttcaggaaatgtcttcaagctggaatgaacttggaa
gcaaggaaaaacaagaagctcaagatgaaaatgcccaggtcacctggatcatcggagccc
gccagtcacatgcctgttgcagtcatccccaggtgcacgccccaactcgtacccaccatg
ctgtcagtactcaaggccatcgaaccagggataatctactctggctatgacggcacgata
cctgacacctcctcgcggctcatgtccactctcaacaagctcgggggacagcaggtcatc
tctgcagtcaagtgggccaagtcactgccaggctttcgcaacctgcacctggatgatcag
atgacactgctgcagtgctcctggctctttctcatgtccttcagtcttggctggaggtca
tatgagcagtgtaacggtagcatgctctgctttgcccctgatcttgtcatcaacaaggag
cgtatgaagctgcccttcatgaccgatcaatgcgagcaaatgttgaggatttgtcatgag
tttgtcagattgcaagtgtcctatgaagagtacctgtgcatgaaggtgcttttgctgctc
agtacagtacctaaagatggtttgaagagccaggcggtgtttgacgagatcaggatgaca
tacatcaaggagctgggaaaagccatcgtcaagagggaggagaatgctactcagaactgg
cagcggttctaccagctaactaagctactggactccatgcaggcgatggtcgagggtctt
ctccagatctgcttttacacttttgtgaataaaaccctcagtgtggaattcccagaaatg
ctggcagagatcatcagcaaccagataccaaaattcaaagatgggagtgtcaaggccctg
ctgtttcatcagaaatga

DBGET integrated database retrieval system