KEGG   Monopterus albus (swamp eel): 109960285
Entry
109960285         CDS       T05607                                 

Gene name
atm
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb03440  Homologous recombination
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    109960285 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109960285 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109960285 (atm)
   04210 Apoptosis
    109960285 (atm)
   04115 p53 signaling pathway
    109960285 (atm)
   04218 Cellular senescence
    109960285 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109960285 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109960285 (atm)
   03400 DNA repair and recombination proteins [BR:malb03400]
    109960285 (atm)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109960285 (atm)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109960285 (atm)
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109960285 (atm)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109960285 (atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC DUF4809
Other DBs
NCBI-GeneID: 109960285
NCBI-ProteinID: XP_020455917
LinkDB
Position
Unknown
AA seq 3084 aa
MSLSLHELLVCCRGLENDRATERKKEAERFRRLLRQPEIVQELDRTSGSKDKTSKQLTWD
AVFRFLQRYVQKETESMQSGKSVTSTTLATRKKKMAETCSLIKYFIRYANKRGPRLKCSE
LLKHVMEVLQSSYSCSAYGEDYSSLLVKDILSVRKYWCDITPEQWHNLLDMYCSFFSSSS
KSINRVLVSRVIHTVVQGCCMQTNGFNNTLFSFFSKALLNAKQEKHLTVLEHLVSALNIF
LRSAAMNCRMRVCHLGEELLPSILYVWADMRPSAVFKEEIVNFFKLQICVHHPRGAKTQD
TGAYAEDWARWRSLLYNLYDALVREIGHIGSRGKYITGMRHIAVKDNLIELTADICHQLF
SDDSDTDMLEVTQAFATQIGSPTHGTASKRRRVKLGWEVLRDHLQPQDSDFDVIPWLQIT
AVLISKYPSMVPSQELAPLLSVLYQFLAEQRRGERGRYVLRCLREVNRCQALYPERAQVH
KAELSKLWGRVWVLALRGVSSPQAEVLSLDLLGSIVQDGLINMDREFWKLFSGCACKPSQ
SAALCLSQALLKCPVPKSLISSSGWDCVGVAEGPGSPNLKESLIAWLLMTDQSDEMEDTS
RPHPIICRDFPYSLIANILVSLTLKDTRAGLKFLLGAEGVECALFQEQASLSPKDSLEEI
ERLYLQFGFNMLPSHIRGTEESMKMSQTDSQFTVVPSLRNKLEQSLLCVADSLLSCYSPD
SQSTSPECLVRCFTLLTGVLAGYIATGYLAEEEACCSQLFTKAKALAQELKDFVSTVKVK
MTEEGTMTTLRSTMKLCTQPASGLDKDNVCSVFSRLFIMILPATLLSELAEICKLLLSSV
SKRVSVVDDGDPIDVDGEITRTQQGDDIDLFEDGEESHSSNNGTHRQKGENTDTSYGPGA
TSLLAEDHLAQQDLALLAVLEFLCKCGSAQPIHGLLFKPQEVRRRLLLLVKQIDFSKALH
INMYLILLKKLPTEDSLSPEEFDSLLRSLADLCNLYRQDQDICAAVLLGLLPSIKTLGKT
HHMLEEMRHVKGSLLEVVSGFCFLSQTGKCIATVRAALVRCLVALLEADPCCKWAVLSPG
REEGRPVSVILPSYLADAHHQVRMLVAMSLERLFVEVKLDHPEERKMLLLKHQQAAFENV
YLKAQEGMRLPRSSSSEEQQDEAFNRKATLLKSLSVVLCCSPVCEKLSLFALFQSYKEND
IEEQLIKKMLCSVSRALGYRSIKTFVSSHLNYLVAEWLGQRQSDDRYCLGSFPYTLLDHN
MVKDFYNSSYQVLIPHLVFLDDFLTVKSIGRCLEKDWKQLLADCFPKIMVNILPYFVISG
HDSQVTQQREKAHRVYDLLKDANCLGKQQIDNLIQSNLADIVVELLLTLYEGGEGDSGDL
KGFIGELDPVPNPPYFSSHVIKATLDYLSKCCSANHKSLVAILSKTPISIQRILLAICER
AAETTNSYERHRIFLMYHLFVNLLLRELKGGLGGSWAFVLRDIIYTLVHHINSRPVQCDE
VSNRSLSLCCDLLSSVCRAALQFCDDAIDCHLQVIVGTLTTQVMSQPAVSQQALSLLQFL
VIENQQKLKGAISRLEPFPNLPEFKQLRSVQQKLKYNNGTFTLRQEITHFLSVTSCDSLP
LTRLEGLKELTRQLHDNKGQIRGLLKECHADPTDSVLVKLVLSLLQLCKLAGSHPGGANI
LEAAGSCLGELGPVDFSTIALLHGRDPLYEKAESRFTSTDSRCLFIILSCMNDALTQQRI
EVRRAAAQCVKNILAAQSGVDFWEQNKDSQDHMLIYLNPFRKAKSMVMAVSAEDRSKARE
RLEEQKFWIPQAVGHKAWLKALCATLLDSGGVRSEALLMSRPLCLVRVDCCQKLLPLIIH
SILLDDVDGSWRKLLSSHIQDFFSFCSRSAQACSRSATPLNSDSESDTASQGLYDKASLR
TMLTVIDYLRHQQRPLESDSNSCPTVCDSNFWLELNYLEVAKAAQSCSAHFTALLYIEIY
VDKIKANMEESCRIKSRATQKLNFEESSQSLTISSLTEKSMEDTNISLQELLIEVYRSIG
EPDSLYGCGGETSSLTRIRTYEHEAMWGKALTAYDLHSTLPEVTRQVGIVEGLQNFGLSS
ILTTYMRGLESEGVEWGAELRELRFQAAWRITQWDCELSERSEKSKPGFHESVFCSLQAL
RDKEFSTFDEMLKQARAAEMEELCRGSLEAVSSLYPALRNLQCIRELESVKQLFSRPFSD
DTLRDVCSQWRQHSQLLVNSDFALVEPILAVRTVAQHTLLSKVGEDPTSSQYITSALTGH
LMELCQLARKAGNTQLAERAVFQMKEHAGGGSWVSSPELSWQLEEAQVFWAKREQGLALG
LLRRMIHNLEEKVAFDPALAPVHTECLRLCGNWLAETCLENPGVILEKYLERAVEVIEGH
SGAQDPRLQSQRTEAFLSLARFSDAQYQSIDKYMRSSEFENKQALLEKAKEEVDLMKERR
VSSNRYTIKVQRELELDEKALSNLQADRQRFLCKAVENYIQCLEQGEEHDTWVFRLASLW
LENADVKAINDMMKKGVKQIPSYKFLPLMYQLAARMGTKMAAGSTEDAGFHDVLNNLICR
ASLEHPHHTLFIILALVNANKDESFCRTRASKSAPPQPSPFDLERSDVARKIINMIRKKR
AELIRGIEYLCDAYITLAYMDASKHKTEKKAIPIPADQPIMQIKNLDEVVIPTVEIKVDP
SGCYDNLVTVQAFKPHYHLVGGVNLPKIIDCVGSDGKSKRQLVKGQDDLRQDAVMQQVFS
MCSMLLQRNTDTRKRKLNIRRYKVVPFSQRSGVLEWCSGTVPIGEFLVDPNKGAHKRFRP
QDWTNLACRMKMMEAQRLAFDGKLQAYNEVCKKFRPVFRFFCMERFLDPAVWMEKRLAYT
RSVATSSIVGYILGLGDRHIQNILVDEQTAELVHIDLGVAFEQGKILPTPETVPFRLSRD
IVDGMGITGVEGVFRRCCEKTMEVMRSSQEALLTIVEVLLYDPLFDWTMNPLKAFYLQHD
EQQELNATLSTTMGGDDIDNHRKSSDSQSFNKVAERVLLRLQEKLKGVEEGTVLSVGGQV
NLLIHQAMDPKNLSRLFPGWQAWV
NT seq 9255 nt   +upstreamnt  +downstreamnt
atgagtctgtctcttcatgagctcctggtctgctgcaggggcctggaaaatgacagagca
acagagaggaagaaagaggctgaacgcttcagacgactccttcgacagccagagattgta
caggagttggatcgaacctcgggatctaaagataaaacctccaagcaactgacatgggat
gctgttttcaggtttctgcagcgttatgttcagaaagagacagaaagcatgcaatcaggc
aaatctgtcacatcgacaacgctggccactcggaagaagaagatggctgaaacatgcagt
ttgatcaaatacttcattcgctatgcaaacaaacgggggccacgtttgaagtgcagcgag
ctactgaaacatgtgatggaggtgctgcagagttcgtatagctgctcagcttatggagaa
gattacagcagcctcctggtgaaggacatcctctctgtccgcaagtactggtgtgacatc
accccagagcagtggcacaaccttttggacatgtactgcagcttcttcagctcgtcatcc
aaatccatcaatcgtgtcttggtgagcagagtcatccacacagtggtgcagggctgctgc
atgcagacgaatggatttaacaacactctgttcagcttcttctccaaagcactgcttaat
gccaagcaggagaagcacctgactgttttggagcatcttgtttcggctctcaacatcttc
ttgagatctgcggccatgaactgtcggatgagggtgtgccacctgggagaggagcttctg
ccttcgatactgtacgtctgggcagatatgagaccaagtgctgtgttcaaagaggagatt
gtgaacttcttcaaactgcaaatatgtgtgcaccaccccagaggagccaagacacaggac
acaggtgcttatgctgaggactgggctcggtggcggagtctgctgtacaacctgtatgat
gctttggtcagagagattggccatataggcagcagagggaagtatatcacagggatgagg
cacatagccgtcaaagacaatctcatcgagctcacagctgacatctgtcaccagctgttt
agtgatgacagtgacaccgatatgttagaggtgacccaggcatttgccactcagataggc
agtcccacccacggaacagccagcaagcggcgccgagtcaaactgggctgggaggtcctc
cgggaccatctgcaacctcaggacagtgactttgatgtcataccatggctgcagatcact
gcagtgctcatctctaaatacccgtccatggtgcccagccaggagctggccccgctgctc
tcagtgttgtaccagtttctagcagagcagcggagaggggagaggggacgctatgtgctg
cgctgtctgagggaggtgaaccgatgccaggccctctacccagagagggcccaagtccac
aaggctgagctcagtaagctgtgggggcgggtgtgggtccttgcgctgcgaggggtcagc
tcacctcaggctgaagttctcagcctagacttgctcggctccattgtccaggatggactg
ataaatatggacagagagttctggaagctcttttctggatgtgcatgcaaaccatcccag
agtgctgcactctgtctctcccaggccctgctaaagtgtccagtccctaaaagtctcata
tcaagctcaggctgggactgtgtgggagtcgcagagggacctgggtcaccgaacctaaag
gagagcctcatagcctggttgctgatgacagatcagagtgatgagatggaggatacctct
agacctcaccccatcatctgcagagattttccctacagtctaatagcgaacatcctggtc
tcccttaccttgaaagacaccagagctggcctgaagtttctgctgggtgctgagggagta
gagtgtgcactttttcaagaacaagcatccctcagccccaaagacagcctggaagagatt
gagaggctgtacttgcagttcggatttaacatgctgccctcacacattcgagggactgaa
gagtcaatgaagatgtcacaaaccgacagccaattcactgtagtccccagcctcagaaac
aagttggagcagtcccttctctgtgtggctgacagcctactcagctgctactctcctgat
tctcagtccacctctccagagtgtctggtgcgctgtttcactctgctgactggtgtccta
gcaggttatatcgccaccggatatttggctgaggaggaggcctgctgctcacagctcttc
actaaagccaaggccctggcccaggagctcaaagattttgtttctactgtgaaagtgaaa
atgacagaggaagggaccatgaccacactgagatccaccatgaagctctgcacacagcca
gccagcggattagacaaggataacgtttgttctgtcttctcccgcctttttattatgatt
ttgcctgctactctgctcagtgaactggcagagatctgcaaactgttgttaagcagtgtc
tctaagagagtcagtgttgtggatgatggtgatcctatagatgttgacggggagattacc
agaactcaacaaggggatgatatcgacctgtttgaggatggtgaagagtcccatagcagc
aacaatgggacccacagacagaagggagaaaacacagacacttcctatgggccaggtgca
acaagcctgttagcagaggaccatctggcccagcaggacctggctcttcttgcagtcttg
gagttcttgtgtaagtgtggctctgcccagcccatccacggcctcctttttaaaccacag
gaggtgcggcgcaggctgctgctgctggtcaagcagatagacttcagcaaagccctccac
atcaatatgtatcttatcctgttgaagaagcttcccacagaggactctctctctccagag
gaatttgattcgctgctccgttctctggctgacctgtgtaacctgtaccgtcaggaccaa
gacatctgtgctgctgtgctgctgggtttgttaccttccatcaagaccctggggaaaacc
catcacatgctggaggagatgagacatgttaagggatctttgctagaagtggtgtctgga
ttctgcttcctgagccaaacgggtaaatgcattgcaactgtgcgagctgctttagtacga
tgtctggttgctttgctggaggctgacccatgttgtaagtgggcagtcctgagccctggc
agagaagagggccgtccggtgtctgtcatccttccatcttaccttgcagatgcccaccac
caagtccgcatgctggtagccatgtcactggagaggttgtttgtggaggtgaaactggat
catccagaagaaaggaagatgttgctgctaaaacaccagcaggctgcttttgaaaatgtt
tacctgaaggctcaggaaggaatgaggctcccgagaagcagctcttcagaggagcagcaa
gatgaggcgttcaaccggaaggccaccctgctgaagagtttgtccgttgtgctgtgttgt
agccccgtgtgtgaaaaactgtctctgttcgccctcttccagtcctacaaggaaaacgat
atcgaggaacagctcatcaaaaagatgttgtgcagtgtatccagagcactgggctacagg
agcataaaaacatttgtcagctcacacctaaactacttggtggctgagtggctcggccag
cgacagtctgacgaccgctactgtcttggatctttcccctacaccctgctagaccacaac
atggtcaaagatttctataactcttcctaccaggtgctaatcccccacctggtcttcctg
gatgactttttaacggtgaagtctatcggcaggtgtctggagaaggactggaaacagctg
ttggccgactgtttccccaagatcatggtcaacattctgccgtactttgtcatatctggt
catgattcacaagttacacagcagagagagaaggcccacagggtgtatgatctgctcaaa
gatgccaactgtctgggcaaacagcaaattgacaacctgatccagagtaacctggcagac
atagtggtggaactgttgctcactctgtatgaaggaggcgaaggtgacagtggagacctg
aaaggctttataggggaactggaccctgtaccaaacccaccatacttcagctcccacgtc
atcaaagctactctggattatctcagcaagtgttgcagtgcaaaccacaagtctttggta
gccattctgtcaaaaactccgatttccatccagaggattctgctggcgatttgtgaacgg
gcagcggagacgaccaacagctatgaacgtcatcgtattttcctcatgtatcacctgttt
gtcaatctgctgcttagagagttaaagggcggtctgggaggatcttgggcctttgttctc
agagacatcatctacacactcgtacaccatatcaacagcagaccagtccagtgtgatgag
gtttctaacaggagcctctctctgtgctgtgacctgttgtcctctgtgtgtcgggcagcg
ctgcagttctgtgatgacgctatagactgccacctacaggtcattgttggaactctcaca
actcaggtgatgagccagcctgccgtctcacagcaggcgctcagtctgttgcagtttctc
gtgattgagaaccagcagaagttgaagggagccataagcaggttggagcctttccccaac
ctccctgaattcaaacagctgcggtctgtacagcagaaactcaagtataacaatgggact
tttacacttagacaggagataacccactttctgtcagtgacgtcctgtgactccttaccc
ctgaccagactggagggactaaaggagctgacccgacagctgcatgacaacaagggacag
atcagagggctgctcaaagagtgccacgctgaccctactgatagtgtgctggtgaagctg
gttctcagtctgctacagctctgtaagctagcaggcagccatcctggaggggccaacatt
ctagaagcagcagggagctgtctgggagaactgggtccagtggatttctccaccatcgcc
ctgctccatggcagagatcccctctatgaaaaggctgagtctcgcttcacctccactgac
tcgcgttgtcttttcatcatcctcagctgcatgaatgatgcgctcactcaacagcgtatt
gaggtgaggcgggcagcagctcagtgtgtgaaaaacatcctcgccgctcagtcgggagtg
gacttctgggagcaaaacaaagacagccaagaccacatgctgatttacctcaatcccttt
agaaaggccaagagcatggtgatggctgtgagtgctgaagacaggtcaaaggctcgggag
aggctcgaggaacagaagttttggattcctcaggcggtcggccacaaggcctggctgaag
gctctgtgcgccaccctgctggacagcggtggtgtcaggagtgaggcgctgctaatgtcg
cgaccgctgtgtctggtgagggtggactgttgtcaaaagttgttacctctcatcatccac
tccatccttctagatgacgtcgacggttcatggaggaagctgctctcgtcccacatccag
gactttttcagcttttgttccagaagtgctcaggcctgcagtcggtctgccacacctctc
aactctgattctgagtcggacactgccagccagggcttgtatgacaaggcttcactgcgt
accatgctgacagttattgactacttaagacatcaacagagaccactggagtctgatagt
aattcatgccccacggtgtgcgactcaaacttctggctggagctgaactatttggaggtg
gccaaagctgctcagtcctgctcagctcacttcaccgctctgctttacattgagatatat
gttgataaaattaaagccaacatggaggaaagttgcagaatcaagtctagagcaacacag
aagctcaattttgaagagagtagccagagcctcaccatctccagcctgactgagaagagt
atggaagacaccaacatcagtctgcaggagttgctgattgaggtgtatcggagcattggg
gagcctgatagtttgtacggctgtggaggggagaccagttcgttgaccaggattcgaacc
tatgagcatgaggctatgtgggggaaggccctgaccgcttatgaccttcactctactctg
cctgaggtcacacgacaagtgggaatcgtggagggcctgcagaactttggcctgagcagc
atcctcacgacctacatgaggggtctggagagtgaaggggtggagtggggagctgagctg
agggagctccgcttccaggctgcctggaggatcacccagtgggactgtgagctgtccgag
aggagtgaaaaatccaaacctggcttccatgaatcagtgttttgttccctgcaagcactg
agggacaaagagttctccacatttgatgaaatgctgaaacaggccagggctgcagaaatg
gaagagctgtgcagaggaagcctagaggctgtgtcttctctgtacccagccctcaggaac
ctgcagtgcatcagggagctggagagtgttaaacagctcttctccaggcctttttcagat
gacactcttagggacgtttgcagtcagtggcgtcagcactcccagctcctcgttaacagc
gacttcgctttagtggagcccattctggcagtccgcactgtggcccagcacaccctgttg
tccaaggtgggagaagaccccaccagcagccagtacatcacctctgcactaacaggccac
ctcatggagctctgccagttggctcgcaaggctgggaatacacagctggcagagcgggca
gttttccagatgaaggagcacgcaggaggagggtcctgggtgtcatcccctgagttgtca
tggcaattggaggaggcccaggtgttttgggcaaagagagagcaggggctggctctgggc
ctgctgagacggatgatacataacctagaagaaaaggtggcctttgatcctgctctggcc
ccagtccacactgagtgtctcaggctttgtggaaactggttggctgagacctgccttgaa
aatcctggagtgatactggagaagtacctggagagggcagtggaggtgatcgaggggcat
tcaggagcgcaagaccccaggctccagagtcagaggactgaggccttcctgtctcttgcc
cgcttctctgatgctcagtaccagagcatcgacaaatacatgcgctcctctgagtttgag
aacaagcaggccttgctggaaaaggccaaagaagaagtggacctgatgaaggagcgtaga
gtgtcatccaacagatacacaataaaggtgcaaagagagctggagctggatgagaaggca
ttgtcgaacctgcaggcagacagacagcgcttcctgtgtaaggcagtggagaattacatc
cagtgtctggaacaaggtgaggagcacgacacctgggtgttccgcctggcttcgctctgg
ctggagaatgctgacgttaaagccataaatgacatgatgaagaaaggggtgaaacagatc
ccctcctacaagtttttgcctctcatgtatcagctggctgcacgcatgggaaccaagatg
gcagctggcagcactgaggatgcgggattccatgatgtccttaacaatctgatctgccga
gcatcactggagcatcctcaccacacgctcttcatcatcctcgccctggtgaacgccaac
aaagacgagagcttctgcaggacgcgggcgtccaagagcgctccaccgcagccatctcca
ttcgacctggagcgttcggacgtggcccggaagatcattaacatgataagaaaaaagaga
gcggagctgatccgtgggatagagtatctgtgtgatgcctacatcactctggcttatatg
gatgccagcaagcacaagactgagaagaaggctattcccatccctgcagatcagcccatc
atgcagatcaaaaacctggatgaggttgttatccccacagtagagatcaaggtggatcca
tccggttgctatgacaacctggtgactgtccaagccttcaagccccattatcacctggtc
ggaggagtcaacctgcccaagatcatagactgtgttggttctgatggaaagagcaagaga
cagttggtcaagggtcaggacgacctgcggcaggatgcagtgatgcagcaggtcttcagc
atgtgctccatgctgctgcaacgcaacacggacactcgcaagagaaagctcaacatcaga
cgatacaaggtggtgccgttctcgcagcgcagcggcgtgttggagtggtgttcaggcacg
gtgcccatcggggagtttctggtggatcccaacaaaggagcacacaaacgcttccggcct
caagactggaccaacttagcttgccgcatgaagatgatggaggcgcagagacttgcattt
gatgggaagctccaagcctacaatgaggtgtgcaagaaattcaggccagtcttcaggttt
ttctgcatggaacggttcctggatcctgcggtgtggatggagaaacggctggcctacacc
cgcagcgtggccacctcctctatagttggctacatcctaggtctgggagacagacatatc
cagaacatcctggttgatgagcagactgctgaactggtgcacattgatttaggcgtggct
tttgagcaaggcaagatcctccccaccccagagactgtccccttcagactctccagagac
atcgtggatgggatgggaatcactggagtggagggagttttcaggaggtgttgtgagaag
accatggaggtgatgaggagctctcaggaagctctgctgactattgtagaggtgctgctg
tacgaccctttgttcgactggaccatgaaccctctgaaggccttctacctgcagcatgac
gagcagcaagagctcaacgcaacgctcagcaccactatgggcggggatgatatagataac
caccgtaaatccagtgacagtcagagcttcaacaaggtggcggagcgagtgctgctgcgg
ctgcaggagaagctgaagggggtggaggagggtacggtgcttagcgtggggggacaggtc
aacctgctcatccaccaagcgatggaccccaaaaacctcagcagactgtttccgggctgg
caagcctgggtgtag

DBGET integrated database retrieval system