KEGG   Monopterus albus (swamp eel): 109960336
Entry
109960336         CDS       T05607                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00562  Inositol phosphate metabolism
malb01100  Metabolic pathways
malb04068  FoxO signaling pathway
malb04070  Phosphatidylinositol signaling system
malb04115  p53 signaling pathway
malb04140  Autophagy - animal
malb04150  mTOR signaling pathway
malb04218  Cellular senescence
malb04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109960336 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109960336 (pten)
   04070 Phosphatidylinositol signaling system
    109960336 (pten)
   04150 mTOR signaling pathway
    109960336 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109960336 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109960336 (pten)
   04218 Cellular senescence
    109960336 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109960336 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109960336 (pten)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109960336 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     109960336 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109960336 (pten)
Protein phosphatases and associated proteins [BR:malb01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109960336 (pten)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 109960336
NCBI-ProteinID: XP_020456014
LinkDB
Position
Unknown
AA seq 435 aa
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRRKFHEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPTPQGFKKGNWHWDPQFVV
YQLKVKIHTSNPTHTRREDKHMLFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEESGDKMENGAVNNAESQQGGPGPDQGQPHSAEVRQSDRDYLILTLTKNDLDKA
NKDKANRYFSPNFKVKLYFTKTVEEPSNSEASTSTSVTPDASDNEPDHYRYSDTTDSDPE
NEPFDEELHTQITKV
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagccgaaacaaaaggagatatcaagaggatggg
ttcgacctagacttaacatatatctatccaaacataattgctatgggatttccagcagag
agactcgaaggcgtgtacagaaacaatatagacgatgtagtacggtttttggattcaaag
cataaaaaccattacaaaatctacaacctctgtgcggaaagacactacgatgctgccaaa
tttaactgcagagttgcacagtacccctttgaagaccacaacccccctcagctggagcta
attaaaccgttttgtgaagacctggacaagtggctcagcgaggatgacaatcacgtggcg
gcaatccactgtaaggctggaaagggccgcactggagtcatgatctgtgcgtatctcctc
catcgacgcaaattccacgaggcccaggaagcgctcgacttttatggtgaagtcaggaca
agggacaaaaagggagtaacgatcccgagccagcgccgctacgtctactactacagctac
ctactcaagaaccagctagagtacaagccggtggcgctcctcttccacaaaatggtgttc
gagactctccccatgttcagcgggggcacctgcagggacagtaccgttaaaaacaggagc
gagccgacccctcagggcttcaagaaagggaattggcattgggatccccagttcgtggtg
taccagctgaaagtgaagattcacacgtcgaaccctactcacacacgacgtgaggacaag
cacatgcttttcgaattcccccagccgctaccggtttgtggagacatcaaagtggagttc
ttccataaacagaataagatgatgaagaaggacaaaatgtttcacttctgggtgaacacc
ttcttcatccctggaccagaagagagcggggacaagatggagaacggggcagtgaacaat
gcagagagccagcagggaggaccgggacctgaccagggccagccacacagtgccgaggtc
aggcaaagcgacagggattatctcatcctgactctcactaagaacgacttggacaaggcc
aacaaagacaaagctaaccgctacttctcgccaaacttcaaggtgaagttgtattttaca
aaaaccgtggaggagccttcaaattctgaagcaagcacttcaacatctgtcacaccggac
gctagcgacaatgagccagaccattatcgatactctgacaccactgactctgatccggaa
aatgaaccttttgatgaagagctgcacacgcaaatcacaaaagtgtga

KEGG   Monopterus albus (swamp eel): 109969673
Entry
109969673         CDS       T05607                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00562  Inositol phosphate metabolism
malb01100  Metabolic pathways
malb04068  FoxO signaling pathway
malb04070  Phosphatidylinositol signaling system
malb04115  p53 signaling pathway
malb04140  Autophagy - animal
malb04150  mTOR signaling pathway
malb04218  Cellular senescence
malb04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109969673
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109969673
   04070 Phosphatidylinositol signaling system
    109969673
   04150 mTOR signaling pathway
    109969673
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109969673
  09143 Cell growth and death
   04115 p53 signaling pathway
    109969673
   04218 Cellular senescence
    109969673
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109969673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109969673
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109969673
    3.1.3.48  protein-tyrosine-phosphatase
     109969673
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109969673
Protein phosphatases and associated proteins [BR:malb01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109969673
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 109969673
NCBI-ProteinID: XP_020472376
LinkDB
Position
Unknown
AA seq 415 aa
MAALIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDEVVRFLDSK
HKSHYKIYNLCAERHYDASKFNCQVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEQHVA
AIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIYYSF
LLRNQLQYKPIALLFHKMLFETVPMFTGGTCNPQFVVYQLKVKIHTSNPTHTRREDKLMI
FELPQPLPVCGDIKVEFFHKQNKMMKKEKMFHFWVNTFFIPGPEENPDKLENGSAGTLRE
LADRTHQNPGTMTAMMVGAETNDRDYLVLTLTKNDLDKANKDKANRNFSPNFKVKLFFTK
TVEEGANCDASSTSASVTPDVSDNEPDHYRYSDTTDSDPENEPFEEDHHNQITKV
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggctgctttaatcaaggaaatcgtcagcagaaataaaaggcgatatcaggaggacggc
ttcgacctggacctgacctatatttatcccaacatcatcgccatgggtttccctgcggag
cgactggagggagtgtataggaacaatattgacgaagttgtccggtttttagactcaaag
cacaagagtcactataagatctacaacctatgtgcagagcgacattatgacgcatcaaag
ttcaactgtcaagttgctcagtatccctttgaggaccacaacccaccccagctggagctg
ataaagccattctgtgaggacctggaccaatggctgagtgaggatgagcagcatgtcgca
gccatccactgcaaggctggaaaaggtcgaaccggtgtcatgatctgtgcctacctgctg
caccgaggcaagtttcaggaagctcaggaggccttggacttctacggagaggtccgcact
cgcgataagaagggtgtgaccattcccagtcagcggcgctacgttatctactacagcttc
ctgttgaggaaccagctgcagtacaaacctatcgctctgctcttccacaagatgctgttt
gaaacggtccccatgttcactggaggcacctgcaaccctcagtttgtcgtttaccagctg
aaggtgaagatccacacctctaaccccacccacacccggagagaagacaaactaatgatc
tttgagctcccgcagccacttcctgtctgtggagacatcaaggtggaattcttccacaag
cagaacaagatgatgaagaaggaaaagatgttccacttctgggtcaacacgttcttcatc
ccaggtccggaggagaacccagacaaactggagaatggcagtgctgggacgttgcgggag
ctggccgacagaacacaccagaacccgggaacgatgactgcaatgatggtgggagcagaa
accaacgacagagactacctggttctcactctgaccaagaacgacctggacaaggccaac
aaagacaaggccaacaggaacttctccccgaacttcaaggtgaaattgttttttaccaag
acggtagaggagggagctaactgtgatgcaagcagcacgtcagcctcggtgacaccagat
gtcagcgacaacgagccggatcactaccgctactccgacacaacggactcggacccagag
aacgagccgtttgaagaggaccaccacaatcagatcacaaaagtctga

DBGET integrated database retrieval system